BLASTX nr result
ID: Mentha22_contig00031514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00031514 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33795.1| hypothetical protein MIMGU_mgv1a000341mg [Mimulus... 57 2e-06 >gb|EYU33795.1| hypothetical protein MIMGU_mgv1a000341mg [Mimulus guttatus] Length = 1232 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +1 Query: 202 METSKNHNPAQFHSSESGNQEHHPESQVSQIDSSAHANVSLKSAETKFSE 351 ME S+NHN QFHS E GN++H ESQ + + S HAN SLKS + FSE Sbjct: 1 MEPSQNHNFVQFHSPEYGNEDHGSESQGFKKEPSGHANASLKSPDITFSE 50