BLASTX nr result
ID: Mentha22_contig00031455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00031455 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309067.1| hypothetical protein POPTR_0006s08760g [Popu... 62 1e-07 gb|EYU26601.1| hypothetical protein MIMGU_mgv1a013978mg [Mimulus... 56 6e-06 >ref|XP_002309067.1| hypothetical protein POPTR_0006s08760g [Populus trichocarpa] gi|222855043|gb|EEE92590.1| hypothetical protein POPTR_0006s08760g [Populus trichocarpa] Length = 261 Score = 61.6 bits (148), Expect = 1e-07 Identities = 40/112 (35%), Positives = 60/112 (53%), Gaps = 19/112 (16%) Frame = -1 Query: 280 MEADMINPVEINS----------IACLNKKRKLQDELLVMPSSKHLCWDQRFVCDFPS-- 137 M+ D +P EINS + CLNKKRKLQDE + +P SKH CWD R + + Sbjct: 1 MDEDSGDPSEINSFQFKEAPNSKLFCLNKKRKLQDEQVGLPISKHKCWDHRLPLETSTIY 60 Query: 136 DSTIDSKMVSSNIFVQGVE-------SEPDFASYSYSFPDNADLSMSSNGDA 2 + + K + ++I + E S+P+ A S SF ++D +MS +G+A Sbjct: 61 EENQEEKDLITHIIKENAERRAIDEGSDPESAKDSNSFVGDSDSAMSVSGEA 112 >gb|EYU26601.1| hypothetical protein MIMGU_mgv1a013978mg [Mimulus guttatus] Length = 204 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 262 NPVEINSIACLNKKRKLQDELLVMPSSKHLCWDQRFVCDFPSDS 131 +P EINSI CL+KKRKLQDELL +P KH+CW Q F S++ Sbjct: 6 SPAEINSIDCLSKKRKLQDELLELPLLKHVCWHQNPELVFSSNN 49