BLASTX nr result
ID: Mentha22_contig00031313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00031313 (473 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25852.1| hypothetical protein MIMGU_mgv1a012991mg [Mimulus... 56 4e-06 >gb|EYU25852.1| hypothetical protein MIMGU_mgv1a012991mg [Mimulus guttatus] Length = 234 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = +2 Query: 8 PPLPPHARKNINIELSSSPPVDKFTSWRSFSLSDLQG 118 PPLPPHAR+ LSSSP D F SWRSFS SDLQG Sbjct: 188 PPLPPHARRAPKSGLSSSPAADNFPSWRSFSFSDLQG 224