BLASTX nr result
ID: Mentha22_contig00031308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00031308 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21218.1| hypothetical protein MIMGU_mgv1a003772mg [Mimulus... 60 2e-07 >gb|EYU21218.1| hypothetical protein MIMGU_mgv1a003772mg [Mimulus guttatus] Length = 565 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +3 Query: 3 DEWVFNTEAHPIKIVPRYDHMGKLGVSESEH-LETRSRARKEGRFHD 140 DEWVFNTEAHPIKI+ R+D GK S +H +ETRSRARKEGR D Sbjct: 521 DEWVFNTEAHPIKIMTRHDLAGK---SVGKHIIETRSRARKEGRLPD 564