BLASTX nr result
ID: Mentha22_contig00031199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00031199 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18652.1| hypothetical protein MIMGU_mgv1a024363mg [Mimulus... 122 4e-26 ref|XP_003535341.1| PREDICTED: putative UDP-glucuronate:xylan al... 60 4e-07 ref|XP_003626298.1| Glycogenin-1 [Medicago truncatula] gi|355501... 59 9e-07 gb|EPS69985.1| plant glycogenin-like starch initiation protein 3... 57 3e-06 >gb|EYU18652.1| hypothetical protein MIMGU_mgv1a024363mg [Mimulus guttatus] Length = 566 Score = 122 bits (307), Expect = 4e-26 Identities = 60/125 (48%), Positives = 87/125 (69%), Gaps = 4/125 (3%) Frame = -1 Query: 364 DEFHSVNRYLESLRNTEWLEVVSRDIIGKR--IEMGLVEAN--PTRDKAPVTPYLKRKRN 197 +EF +V+ YL +LRN EW + +SRD+I + IE+ L+ A P+ + + N Sbjct: 42 EEFQNVSAYLRTLRNPEWFDALSRDLIREEDEIEISLMNAGRFPSHARRTGADVKTARDN 101 Query: 196 PGWFEVVSREFKDETINIGLVNVDETVDGVQTKAKMVRVHFERVGEELRWPELSPELVYE 17 P WF+ V+R+F+DE +NIGLVNVD T+D V+T+A+MV V FERVGEE++W +L+PE + Sbjct: 102 PEWFDFVARKFRDERMNIGLVNVDPTLDEVRTRAEMVEVRFERVGEEVKWSDLAPERIDA 161 Query: 16 NSTCP 2 NSTCP Sbjct: 162 NSTCP 166 >ref|XP_003535341.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4-like [Glycine max] Length = 573 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 8/93 (8%) Frame = -1 Query: 268 MGLVEANPTRDKAPVTPYLKRKRNPGWFEVVSREFKDETINIGLVNVDETVDG------- 110 + L+ P R + KR P WFEV+ + + + IN+GLVNVD VDG Sbjct: 29 LSLLSMKPKRVSNVTNKFEVDKRKPSWFEVIEKNYASKRINVGLVNVDTRVDGGLYEQLH 88 Query: 109 -VQTKAKMVRVHFERVGEELRWPELSPELVYEN 14 + + ++V V F+ V E L+W + P + E+ Sbjct: 89 ALHPQVEIVSVDFDHVDESLKWKDFFPVWIDED 121 >ref|XP_003626298.1| Glycogenin-1 [Medicago truncatula] gi|355501313|gb|AES82516.1| Glycogenin-1 [Medicago truncatula] Length = 561 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/66 (40%), Positives = 45/66 (68%), Gaps = 6/66 (9%) Frame = -1 Query: 196 PGWFEVVSREFKDET-INIGLVNVD-----ETVDGVQTKAKMVRVHFERVGEELRWPELS 35 P WFEV++++FK +T I IGLV+++ E +DG +++ +V +HF+RV E L+W + Sbjct: 51 PSWFEVIAQDFKSKTKIKIGLVDINPRSIGEQLDGNRSRVDIVPIHFDRVSENLKWSDFF 110 Query: 34 PELVYE 17 PE + E Sbjct: 111 PEWIDE 116 >gb|EPS69985.1| plant glycogenin-like starch initiation protein 3 [Genlisea aurea] Length = 552 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/74 (40%), Positives = 47/74 (63%), Gaps = 6/74 (8%) Frame = -1 Query: 205 KRNPGWFEVVSREFKDETINIGLVNVDETVDG---VQTKAKMVRVHFE--RVGEEL-RWP 44 +R+ WF+VV RE + I+IG++N D T++G V AK V V F R G+++ RW Sbjct: 83 RRSSKWFQVVKRELGSDRIDIGVLNGDSTMNGDEEVHGNAKFVTVEFSPVRCGDDMIRWS 142 Query: 43 ELSPELVYENSTCP 2 +L+PE + ++S CP Sbjct: 143 DLAPERINKSSKCP 156