BLASTX nr result
ID: Mentha22_contig00031198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00031198 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18652.1| hypothetical protein MIMGU_mgv1a024363mg [Mimulus... 109 3e-22 gb|EPS69985.1| plant glycogenin-like starch initiation protein 3... 64 2e-08 ref|XP_003626298.1| Glycogenin-1 [Medicago truncatula] gi|355501... 62 1e-07 ref|XP_003535341.1| PREDICTED: putative UDP-glucuronate:xylan al... 58 1e-06 >gb|EYU18652.1| hypothetical protein MIMGU_mgv1a024363mg [Mimulus guttatus] Length = 566 Score = 109 bits (273), Expect = 3e-22 Identities = 55/109 (50%), Positives = 75/109 (68%), Gaps = 4/109 (3%) Frame = -3 Query: 316 EWLEVFSRDIVGKR--IEVGLVEADATRDKAPATPYLKK--KRNPEWFEVVSREFKDETI 149 EW + SRD++ + IE+ L+ A A T K + NPEWF+ V+R+F+DE + Sbjct: 58 EWFDALSRDLIREEDEIEISLMNAGRFPSHARRTGADVKTARDNPEWFDFVARKFRDERM 117 Query: 148 NIGLVNVDETADGVQTKAKMVRVHFERVGEDLRWSDLSPEHVYENSTCP 2 NIGLVNVD T D V+T+A+MV V FERVGE+++WSDL+PE + NSTCP Sbjct: 118 NIGLVNVDPTLDEVRTRAEMVEVRFERVGEEVKWSDLAPERIDANSTCP 166 >gb|EPS69985.1| plant glycogenin-like starch initiation protein 3 [Genlisea aurea] Length = 552 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/89 (40%), Positives = 54/89 (60%), Gaps = 6/89 (6%) Frame = -3 Query: 250 DATRDKAPATPYLKKKRNPEWFEVVSREFKDETINIGLVNVDETADG---VQTKAKMVRV 80 ++ D+ A P +R+ +WF+VV RE + I+IG++N D T +G V AK V V Sbjct: 72 ESKHDETAAVP----RRSSKWFQVVKRELGSDRIDIGVLNGDSTMNGDEEVHGNAKFVTV 127 Query: 79 HFE--RVGEDL-RWSDLSPEHVYENSTCP 2 F R G+D+ RWSDL+PE + ++S CP Sbjct: 128 EFSPVRCGDDMIRWSDLAPERINKSSKCP 156 >ref|XP_003626298.1| Glycogenin-1 [Medicago truncatula] gi|355501313|gb|AES82516.1| Glycogenin-1 [Medicago truncatula] Length = 561 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/66 (43%), Positives = 46/66 (69%), Gaps = 6/66 (9%) Frame = -3 Query: 196 PEWFEVVSREFKDET-INIGLVNVD-----ETADGVQTKAKMVRVHFERVGEDLRWSDLS 35 P WFEV++++FK +T I IGLV+++ E DG +++ +V +HF+RV E+L+WSD Sbjct: 51 PSWFEVIAQDFKSKTKIKIGLVDINPRSIGEQLDGNRSRVDIVPIHFDRVSENLKWSDFF 110 Query: 34 PEHVYE 17 PE + E Sbjct: 111 PEWIDE 116 >ref|XP_003535341.1| PREDICTED: putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4-like [Glycine max] Length = 573 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/72 (37%), Positives = 40/72 (55%), Gaps = 8/72 (11%) Frame = -3 Query: 205 KRNPEWFEVVSREFKDETINIGLVNVDETADG--------VQTKAKMVRVHFERVGEDLR 50 KR P WFEV+ + + + IN+GLVNVD DG + + ++V V F+ V E L+ Sbjct: 50 KRKPSWFEVIEKNYASKRINVGLVNVDTRVDGGLYEQLHALHPQVEIVSVDFDHVDESLK 109 Query: 49 WSDLSPEHVYEN 14 W D P + E+ Sbjct: 110 WKDFFPVWIDED 121