BLASTX nr result
ID: Mentha22_contig00031189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00031189 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237403.1| PREDICTED: lipoxygenase homology domain-cont... 67 3e-09 ref|XP_006355360.1| PREDICTED: lipoxygenase homology domain-cont... 62 8e-08 ref|XP_002533143.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 >ref|XP_004237403.1| PREDICTED: lipoxygenase homology domain-containing protein 1-like [Solanum lycopersicum] Length = 188 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 323 TGVHEQCSQQYFEVEQWLATDAPPRELTAIRDLC 222 TGVH+QC+QQYFEVEQWLATDA P +LTAIRDLC Sbjct: 131 TGVHKQCNQQYFEVEQWLATDASPYQLTAIRDLC 164 >ref|XP_006355360.1| PREDICTED: lipoxygenase homology domain-containing protein 1-like [Solanum tuberosum] Length = 197 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -3 Query: 323 TGVHEQCSQQYFEVEQWLATDAPPRELTAIRDLC 222 TGVH++C+QQ FEVEQWLATDA P +LTAIRDLC Sbjct: 145 TGVHKKCNQQNFEVEQWLATDASPYQLTAIRDLC 178 >ref|XP_002533143.1| conserved hypothetical protein [Ricinus communis] gi|223527054|gb|EEF29239.1| conserved hypothetical protein [Ricinus communis] Length = 177 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -3 Query: 323 TGVHEQCSQQYFEVEQWLATDAPPRELTAIRDLC 222 +GVH CSQQ F VEQWLATDAPP ELTAIR+ C Sbjct: 122 SGVHATCSQQQFTVEQWLATDAPPYELTAIRNYC 155