BLASTX nr result
ID: Mentha22_contig00030428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00030428 (390 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS62651.1| hypothetical protein M569_12141, partial [Genlise... 57 3e-06 >gb|EPS62651.1| hypothetical protein M569_12141, partial [Genlisea aurea] Length = 190 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = +3 Query: 261 MPPTSXXXXXXXXXXXXWTFNVVTSVGIIIVNKALMASYGFSF 389 MPP S W FNVVTSVG+IIVNKALMASYGFSF Sbjct: 1 MPPPSKADKKAAVDAAAWLFNVVTSVGVIIVNKALMASYGFSF 43