BLASTX nr result
ID: Mentha22_contig00030291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00030291 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45055.1| hypothetical protein MIMGU_mgv1a003403mg [Mimulus... 70 2e-10 >gb|EYU45055.1| hypothetical protein MIMGU_mgv1a003403mg [Mimulus guttatus] Length = 587 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +1 Query: 220 AAAGKSYWRFSKQDFFPEPSFENGATYLTALSKTPH 327 AAAGKSYWRF+KQDFFPEP+F+N +TYL+ALSKTPH Sbjct: 8 AAAGKSYWRFTKQDFFPEPTFQNFSTYLSALSKTPH 43