BLASTX nr result
ID: Mentha22_contig00030280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00030280 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28521.1| hypothetical protein MIMGU_mgv1a0158822mg, partia... 61 1e-07 gb|EYU26750.1| hypothetical protein MIMGU_mgv1a010562mg [Mimulus... 59 9e-07 >gb|EYU28521.1| hypothetical protein MIMGU_mgv1a0158822mg, partial [Mimulus guttatus] Length = 125 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +2 Query: 8 SEEPRPDNQKASEDAVAAAKDRHKRNEDAIAAAKERFLARKRAK 139 S + P +QK S DAV AKD HKR+EDA+AAAKERFLARK++K Sbjct: 81 SNQVTPGDQKKSNDAVVEAKDHHKRSEDAVAAAKERFLARKKSK 124 >gb|EYU26750.1| hypothetical protein MIMGU_mgv1a010562mg [Mimulus guttatus] Length = 309 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +2 Query: 8 SEEPRPDNQKASEDAVAAAKDRHKRNEDAIAAAKERFLARKRAK 139 S + P + K SEDAV AK+ HKR+EDA+AAAKERFLARK++K Sbjct: 265 SNQVTPGDLKKSEDAVVEAKNHHKRSEDAVAAAKERFLARKKSK 308