BLASTX nr result
ID: Mentha22_contig00030018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00030018 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37976.1| hypothetical protein MIMGU_mgv1a011109mg [Mimulus... 72 8e-11 >gb|EYU37976.1| hypothetical protein MIMGU_mgv1a011109mg [Mimulus guttatus] Length = 292 Score = 72.0 bits (175), Expect = 8e-11 Identities = 38/66 (57%), Positives = 44/66 (66%), Gaps = 1/66 (1%) Frame = -3 Query: 196 MATALSVRPSRAISGSDRPGSTSFRRTGRGPVVNVLNPGRRRPWGVMLARRMLAAPLQA- 20 MATA SVRP+ ++GSD ST RRTG+ P + V N G R WG + RR LA PLQA Sbjct: 1 MATAFSVRPNLTVAGSDLTRSTYLRRTGQDPAIKVFNSGGRFQWGALFTRRPLAPPLQAG 60 Query: 19 SRADDS 2 SRADDS Sbjct: 61 SRADDS 66