BLASTX nr result
ID: Mentha22_contig00030009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00030009 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34951.1| hypothetical protein MIMGU_mgv1a007774mg [Mimulus... 59 7e-07 >gb|EYU34951.1| hypothetical protein MIMGU_mgv1a007774mg [Mimulus guttatus] Length = 395 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/39 (76%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -1 Query: 412 FGLLHEVLRKQLFGKSEE-GIVRPVLEKLPKTESPLLPP 299 FG LHEVLRKQLFGKSEE G RP+L KLPK +PLLPP Sbjct: 334 FGHLHEVLRKQLFGKSEESGFRRPMLSKLPKNGTPLLPP 372