BLASTX nr result
ID: Mentha22_contig00029814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00029814 (550 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32203.3| unnamed protein product [Vitis vinifera] 102 6e-20 ref|YP_001312257.1| hypothetical protein CYtaCp092 [Cycas taitun... 82 7e-14 ref|XP_006830102.1| hypothetical protein AMTR_s05231p00006790, p... 80 3e-13 ref|XP_006854725.1| hypothetical protein AMTR_s00030p00239160 [A... 66 5e-09 >emb|CBI32203.3| unnamed protein product [Vitis vinifera] Length = 83 Score = 102 bits (254), Expect = 6e-20 Identities = 51/55 (92%), Positives = 51/55 (92%) Frame = +3 Query: 111 MRFIVALLIASLFVDKADSELSVIRRHNLYSCASYSPGVRSQKYSHPCPLTSIPR 275 MRFIVALLIASLFVDKADSELS I RHNLY CASYSPGVRSQKYSHP PLTSIPR Sbjct: 1 MRFIVALLIASLFVDKADSELSFIPRHNLYPCASYSPGVRSQKYSHPYPLTSIPR 55 >ref|YP_001312257.1| hypothetical protein CYtaCp092 [Cycas taitungensis] gi|150251549|ref|YP_001312281.1| hypothetical protein CYtaCp116 [Cycas taitungensis] gi|452848926|ref|YP_007474604.1| hypothetical_protein (chloroplast) [Cycas revoluta] gi|452849009|ref|YP_007474688.1| hypothetical_protein (chloroplast) [Cycas revoluta] gi|149941575|dbj|BAF64999.1| hypothetical protein (chloroplast) [Cycas taitungensis] gi|149941599|dbj|BAF65023.1| hypothetical protein (chloroplast) [Cycas taitungensis] gi|372863081|gb|AEX99154.1| hypothetical_protein (chloroplast) [Cycas revoluta] gi|372863164|gb|AEX99237.1| hypothetical_protein (chloroplast) [Cycas revoluta] Length = 67 Score = 82.4 bits (202), Expect = 7e-14 Identities = 44/59 (74%), Positives = 45/59 (76%) Frame = +3 Query: 111 MRFIVALLIASLFVDKADSELSVIRRHNLYSCASYSPGVRSQKYSHPCPLTSIPRSKID 287 MRFIVALLIA FVDKADSEL I RHNLY ASY PGV SQ YSHP PL SIPR+ D Sbjct: 1 MRFIVALLIAPFFVDKADSELFFIPRHNLYPFASYQPGVHSQ-YSHPYPLMSIPRASYD 58 >ref|XP_006830102.1| hypothetical protein AMTR_s05231p00006790, partial [Amborella trichopoda] gi|548835948|gb|ERM97518.1| hypothetical protein AMTR_s05231p00006790, partial [Amborella trichopoda] Length = 77 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 154 TKQIRNCLSFEGITCIHALHIRPEFAPRNIAIPAPSRQSHD 276 TK+IRNCLSF+GITCIHALHIR EFAPRNIAIP PSRQSH+ Sbjct: 1 TKRIRNCLSFQGITCIHALHIRLEFAPRNIAIPTPSRQSHE 41 >ref|XP_006854725.1| hypothetical protein AMTR_s00030p00239160 [Amborella trichopoda] gi|548858411|gb|ERN16192.1| hypothetical protein AMTR_s00030p00239160 [Amborella trichopoda] Length = 89 Score = 66.2 bits (160), Expect = 5e-09 Identities = 36/56 (64%), Positives = 41/56 (73%) Frame = +3 Query: 111 MRFIVALLIASLFVDKADSELSVIRRHNLYSCASYSPGVRSQKYSHPCPLTSIPRS 278 MRFIVALLIAS FVDKADSELS I RHNL SC +Q+YSH PL S+P++ Sbjct: 1 MRFIVALLIASFFVDKADSELSFIPRHNLCSC--------TQQYSHSYPLKSLPQA 48