BLASTX nr result
ID: Mentha22_contig00029695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00029695 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40784.1| hypothetical protein MIMGU_mgv1a0215071mg, partia... 61 9e-10 gb|EYU40782.1| hypothetical protein MIMGU_mgv1a020244mg [Mimulus... 52 1e-06 gb|EYU40786.1| hypothetical protein MIMGU_mgv11b002117mg [Mimulu... 51 3e-06 >gb|EYU40784.1| hypothetical protein MIMGU_mgv1a0215071mg, partial [Mimulus guttatus] Length = 232 Score = 61.2 bits (147), Expect(2) = 9e-10 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = +1 Query: 133 SSNKFLIHDTTLQLFLELPQCVTFTNFSLPHSPSAALTFSPNITFFTCYNET 288 S+NKFL+ D +LQ L+ C +F N +LP PS + +FSPN+T F C+NET Sbjct: 77 STNKFLVKDHSLQSLLDTNSCFSFINLTLPKYPSISFSFSPNLTMFECFNET 128 Score = 27.3 bits (59), Expect(2) = 9e-10 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 8 FTKSSHPDCGLFMVHNCDS 64 F S+ CGLF VH CDS Sbjct: 39 FPLSNSRGCGLFTVHGCDS 57 >gb|EYU40782.1| hypothetical protein MIMGU_mgv1a020244mg [Mimulus guttatus] Length = 576 Score = 52.4 bits (124), Expect(2) = 1e-06 Identities = 25/50 (50%), Positives = 31/50 (62%) Frame = +1 Query: 133 SSNKFLIHDTTLQLFLELPQCVTFTNFSLPHSPSAALTFSPNITFFTCYN 282 S+N FLI D TLQ+ L+ C F N SLP SPS + + S N+T F C N Sbjct: 80 STNSFLIKDHTLQVQLDNMSCFAFRNVSLPKSPSISFSVSSNLTMFACVN 129 Score = 25.4 bits (54), Expect(2) = 1e-06 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 8 FTKSSHPDCGLFMVHNCDSE 67 F S+ CGLF V +CDS+ Sbjct: 41 FPLSNSTGCGLFTVDDCDSD 60 >gb|EYU40786.1| hypothetical protein MIMGU_mgv11b002117mg [Mimulus guttatus] Length = 653 Score = 51.2 bits (121), Expect(2) = 3e-06 Identities = 27/57 (47%), Positives = 31/57 (54%) Frame = +1 Query: 112 YLIMGKPSSNKFLIHDTTLQLFLELPQCVTFTNFSLPHSPSAALTFSPNITFFTCYN 282 Y I S+N FLI D +LQ L C F N SLP SPS + + SPN T F C N Sbjct: 73 YNISRNMSTNSFLIKDHSLQWQLNSNSCFAFRNVSLPKSPSISFSVSPNRTVFACVN 129 Score = 25.4 bits (54), Expect(2) = 3e-06 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +2 Query: 2 FPFTKSSHPDCGLFMVHNCDSE 67 FP + S+ CGLF V +CDS+ Sbjct: 41 FPISNST--GCGLFTVDDCDSD 60