BLASTX nr result
ID: Mentha22_contig00029503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00029503 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42651.1| hypothetical protein MIMGU_mgv1a013033mg [Mimulus... 57 4e-06 >gb|EYU42651.1| hypothetical protein MIMGU_mgv1a013033mg [Mimulus guttatus] Length = 232 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/46 (54%), Positives = 27/46 (58%) Frame = +3 Query: 3 YYPYWGRIFIPHMANGAIXXXXXXXXXXXXKPQKASENNHVDPEAD 140 YYPYWGRI IPH ANGAI KPQK SE+N D + D Sbjct: 180 YYPYWGRILIPHFANGAILRTLWFMFLWYRKPQKTSEHNQTDSKTD 225