BLASTX nr result
ID: Mentha22_contig00026950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00026950 (545 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21777.1| hypothetical protein MIMGU_mgv1a011325mg [Mimulus... 65 1e-08 >gb|EYU21777.1| hypothetical protein MIMGU_mgv1a011325mg [Mimulus guttatus] Length = 285 Score = 65.1 bits (157), Expect = 1e-08 Identities = 35/50 (70%), Positives = 37/50 (74%) Frame = +1 Query: 1 ARLEQALKSGQLPADLNIIDVDDAPKGEADQQEDNMNTDEKEANNEPKES 150 ARLEQALKSGQLPAD NI D D P+ Q DNM TDEKEAN EPK+S Sbjct: 224 ARLEQALKSGQLPADFNINDDDTTPE---SAQPDNMITDEKEANGEPKDS 270 Database: ./nr Posted date: May 19, 2014 3:28 PM Number of letters in database: 13,856,398,315 Number of sequences in database: 38,876,450 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 38876450 Number of Hits to DB: 395,496,183,885,573 Number of extensions: -1589334407 Number of successful extensions: 891205048 Number of sequences better than 1.0e-05: 83521116 Number of HSP's gapped: 581314519 Number of HSP's successfully gapped: 122289543 Length of database: 13,856,398,315 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 30 (16.2 bits)