BLASTX nr result
ID: Mentha22_contig00026776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00026776 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21819.1| hypothetical protein MIMGU_mgv1a001371mg [Mimulus... 61 2e-07 >gb|EYU21819.1| hypothetical protein MIMGU_mgv1a001371mg [Mimulus guttatus] Length = 832 Score = 60.8 bits (146), Expect = 2e-07 Identities = 35/49 (71%), Positives = 39/49 (79%), Gaps = 4/49 (8%) Frame = +1 Query: 1 LILTKEEAQRMSPGTF--KGEVNSIVAEGTDAEEMKSLP--TSSSGPDD 135 LILTKEE QRMSPGTF KGE S VAEG DA+E+K+LP TSSS PD+ Sbjct: 783 LILTKEEVQRMSPGTFNSKGEEMSSVAEGLDAKEVKNLPATTSSSSPDN 831