BLASTX nr result
ID: Mentha22_contig00026564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00026564 (632 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18729.1| hypothetical protein MIMGU_mgv1a001312mg [Mimulus... 61 2e-07 >gb|EYU18729.1| hypothetical protein MIMGU_mgv1a001312mg [Mimulus guttatus] Length = 842 Score = 61.2 bits (147), Expect = 2e-07 Identities = 31/60 (51%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = +2 Query: 2 ARVPPSAKMYKDMEFFAQTSSGSENAAAIRERLDALKSKYGYSTAEDEN-NPSLPTNALI 178 A VPPS +MY ++ +A TS+G EN AAIRER+++LK K GYS + + +P LP N+LI Sbjct: 780 AGVPPSPQMYNNILSYAHTSAGPENGAAIRERIESLKRKSGYSLLKSKGCDPPLPANSLI 839