BLASTX nr result
ID: Mentha22_contig00026371
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00026371 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC03893.1| hypothetical protein L484_016097 [Morus notabilis] 56 4e-06 >gb|EXC03893.1| hypothetical protein L484_016097 [Morus notabilis] Length = 1137 Score = 56.2 bits (134), Expect = 4e-06 Identities = 43/130 (33%), Positives = 58/130 (44%), Gaps = 5/130 (3%) Frame = +3 Query: 42 DARPAELMPRSRPVVSGRGREVSNGRDDGRKSMVSRSHNKPKVGLE-----THASKSSTE 206 D R A++ +S+ + GR+V +G RKS+ H KVG + + S T+ Sbjct: 211 DTRLAQVPVKSKQALGNNGRQV-HGNHGERKSVPMNGHPSSKVGSNKLPSASRPNSSQTD 269 Query: 207 ARKHSSINNGSGPGRPLGXXXXXXXXXXXXXXXXXXTGKVNRPLAKSNISGARKPTPSPL 386 +RK S NNG+GPGRPL KV P AKS S P PS Sbjct: 270 SRKQHSSNNGTGPGRPLAPKGMPSKTPTSMEK------KVATPAAKS--SAPSMPRPSMQ 321 Query: 387 QPVARKPAPS 416 +P + K PS Sbjct: 322 KPPSSKQQPS 331