BLASTX nr result
ID: Mentha22_contig00026287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00026287 (605 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36047.1| hypothetical protein MIMGU_mgv1a013651mg [Mimulus... 73 7e-11 gb|EPS60413.1| hypothetical protein M569_14391, partial [Genlise... 64 4e-08 ref|XP_004168988.1| PREDICTED: methyl-CpG-binding domain-contain... 63 6e-08 ref|XP_006362862.1| PREDICTED: methyl-CpG-binding domain-contain... 61 2e-07 ref|XP_004294545.1| PREDICTED: methyl-CpG-binding domain-contain... 59 1e-06 ref|XP_007016410.1| Methyl-CPG-binding domain protein 5, putativ... 59 1e-06 ref|XP_007016409.1| Methyl-CPG-binding domain protein 5, putativ... 59 1e-06 ref|XP_002532846.1| DNA binding protein, putative [Ricinus commu... 58 2e-06 ref|XP_006369524.1| hypothetical protein POPTR_0001s24690g [Popu... 57 5e-06 ref|XP_006369523.1| hypothetical protein POPTR_0001s24690g [Popu... 57 5e-06 ref|XP_002299872.1| methyl-CpG-binding domain-containing family ... 57 5e-06 ref|XP_002314180.1| methyl-CpG-binding domain-containing family ... 56 7e-06 ref|XP_004251081.1| PREDICTED: methyl-CpG-binding domain-contain... 56 9e-06 >gb|EYU36047.1| hypothetical protein MIMGU_mgv1a013651mg [Mimulus guttatus] Length = 214 Score = 72.8 bits (177), Expect = 7e-11 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -3 Query: 603 LRVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 LRVRSSGATAGLIDRYYVEP+G+R+FRSK EV+HYLETG Sbjct: 118 LRVRSSGATAGLIDRYYVEPSGNRKFRSKNEVVHYLETG 156 >gb|EPS60413.1| hypothetical protein M569_14391, partial [Genlisea aurea] Length = 216 Score = 63.5 bits (153), Expect = 4e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 603 LRVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 L++R+SGA+ G IDRYY EPTG RRFRSK EVLH+LE+G Sbjct: 103 LKIRNSGASKGHIDRYYAEPTGQRRFRSKTEVLHFLESG 141 >ref|XP_004168988.1| PREDICTED: methyl-CpG-binding domain-containing protein 6-like [Cucumis sativus] Length = 206 Score = 63.2 bits (152), Expect = 6e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 RVRSSGATAG +D+YY +P +RRFRSKIEVL++LETG Sbjct: 153 RVRSSGATAGTVDKYYFDPVSNRRFRSKIEVLYFLETG 190 >ref|XP_006362862.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Solanum tuberosum] Length = 245 Score = 61.2 bits (147), Expect = 2e-07 Identities = 32/72 (44%), Positives = 41/72 (56%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETGXXXXXXXXXXXXXXXXXXXXXS 421 +VR+SGATAG +DRYY EP +FRSK EVL++LETG Sbjct: 111 KVRTSGATAGTVDRYYYEPVSGSKFRSKTEVLYFLETGGKRKKAITGSGTDATPSETPPI 170 Query: 420 QKQRKSNTKRKK 385 +KQ+KS +K KK Sbjct: 171 KKQKKSISKTKK 182 >ref|XP_004294545.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Fragaria vesca subsp. vesca] Length = 209 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 +VRSSGATAG DRYY +P RRFRSK EVLH+LETG Sbjct: 84 KVRSSGATAGSTDRYYHDPVSGRRFRSKKEVLHFLETG 121 >ref|XP_007016410.1| Methyl-CPG-binding domain protein 5, putative isoform 2 [Theobroma cacao] gi|508786773|gb|EOY34029.1| Methyl-CPG-binding domain protein 5, putative isoform 2 [Theobroma cacao] Length = 212 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 RVR+SGATAG +D+YYV+P+ R+FRSK EVL+++ETG Sbjct: 81 RVRTSGATAGTVDKYYVDPSSGRKFRSKKEVLYFIETG 118 >ref|XP_007016409.1| Methyl-CPG-binding domain protein 5, putative isoform 1 [Theobroma cacao] gi|508786772|gb|EOY34028.1| Methyl-CPG-binding domain protein 5, putative isoform 1 [Theobroma cacao] Length = 232 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 RVR+SGATAG +D+YYV+P+ R+FRSK EVL+++ETG Sbjct: 81 RVRTSGATAGTVDKYYVDPSSGRKFRSKKEVLYFIETG 118 >ref|XP_002532846.1| DNA binding protein, putative [Ricinus communis] gi|223527383|gb|EEF29524.1| DNA binding protein, putative [Ricinus communis] Length = 234 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 RVR+SGATAG +D+YY+EP RRFRSK EV ++LETG Sbjct: 109 RVRASGATAGTVDKYYIEPVTGRRFRSKKEVQYFLETG 146 >ref|XP_006369524.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa] gi|550348102|gb|ERP66093.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa] Length = 167 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 RVR+SGATAG D+YY+EP RRFRSK +V +YLETG Sbjct: 83 RVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG 120 >ref|XP_006369523.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa] gi|550348101|gb|ERP66092.1| hypothetical protein POPTR_0001s24690g [Populus trichocarpa] Length = 162 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 RVR+SGATAG D+YY+EP RRFRSK +V +YLETG Sbjct: 83 RVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG 120 >ref|XP_002299872.1| methyl-CpG-binding domain-containing family protein [Populus trichocarpa] gi|118483055|gb|ABK93437.1| unknown [Populus trichocarpa] gi|222847130|gb|EEE84677.1| methyl-CpG-binding domain-containing family protein [Populus trichocarpa] Length = 214 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 RVR+SGATAG D+YY+EP RRFRSK +V +YLETG Sbjct: 83 RVRTSGATAGTRDKYYIEPVSGRRFRSKKDVQYYLETG 120 >ref|XP_002314180.1| methyl-CpG-binding domain-containing family protein [Populus trichocarpa] gi|222850588|gb|EEE88135.1| methyl-CpG-binding domain-containing family protein [Populus trichocarpa] Length = 214 Score = 56.2 bits (134), Expect = 7e-06 Identities = 23/38 (60%), Positives = 32/38 (84%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 R+R+SGATAG +D+YY++P R+FRSK +V +YLETG Sbjct: 83 RIRTSGATAGTVDKYYIDPASGRKFRSKKDVQYYLETG 120 >ref|XP_004251081.1| PREDICTED: methyl-CpG-binding domain-containing protein 5-like [Solanum lycopersicum] Length = 248 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 600 RVRSSGATAGLIDRYYVEPTGHRRFRSKIEVLHYLETG 487 +VR+SGATAG +DRYY EP +FRSK EVL++LETG Sbjct: 111 KVRTSGATAGTVDRYYYEPVTGSKFRSKTEVLYFLETG 148