BLASTX nr result
ID: Mentha22_contig00025487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00025487 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD32507.1| transposase, putative [Medicago truncatula] 59 7e-07 >gb|ABD32507.1| transposase, putative [Medicago truncatula] Length = 153 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = -3 Query: 408 LQGCLTEIMKVKGHNNYKIPHMCKDRLIREGTLPVSLTIPMDLAKESIQFL 256 LQ C+ EIMKVKG NNYKIPHM K+ L+R LP L +L +E+ ++L Sbjct: 97 LQSCMIEIMKVKGSNNYKIPHMDKEMLLRRSMLPKQLKCDPELFQETFEYL 147