BLASTX nr result
ID: Mentha22_contig00025384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00025384 (631 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004300309.1| PREDICTED: casein kinase II subunit beta-lik... 68 2e-09 ref|XP_004300307.1| PREDICTED: casein kinase II subunit beta-lik... 68 2e-09 ref|XP_006385581.1| hypothetical protein POPTR_0003s08300g [Popu... 68 3e-09 gb|EPS57799.1| hypothetical protein M569_17018, partial [Genlise... 67 3e-09 ref|XP_006375187.1| Casein kinase II beta-3 subunit family prote... 67 4e-09 gb|EXB38353.1| Putative casein kinase II subunit beta-4 [Morus n... 67 6e-09 ref|XP_006477066.1| PREDICTED: casein kinase II subunit beta-lik... 67 6e-09 ref|XP_006477065.1| PREDICTED: casein kinase II subunit beta-lik... 67 6e-09 ref|XP_006477064.1| PREDICTED: casein kinase II subunit beta-lik... 67 6e-09 ref|XP_006440147.1| hypothetical protein CICLE_v10021529mg [Citr... 67 6e-09 ref|XP_006440146.1| hypothetical protein CICLE_v10021529mg [Citr... 67 6e-09 ref|XP_006440145.1| hypothetical protein CICLE_v10021529mg [Citr... 67 6e-09 ref|XP_002269020.1| PREDICTED: putative casein kinase II subunit... 67 6e-09 emb|CAN72327.1| hypothetical protein VITISV_022015 [Vitis vinifera] 67 6e-09 ref|XP_006445463.1| hypothetical protein CICLE_v10021491mg [Citr... 66 1e-08 ref|XP_006445462.1| hypothetical protein CICLE_v10021491mg [Citr... 66 1e-08 ref|XP_006414205.1| hypothetical protein EUTSA_v10025930mg [Eutr... 66 1e-08 ref|XP_006414204.1| hypothetical protein EUTSA_v10025930mg [Eutr... 66 1e-08 ref|XP_007220529.1| hypothetical protein PRUPE_ppa009433mg [Prun... 66 1e-08 gb|AEK26563.1| casein kinase II beta subunit [Populus tremula] g... 66 1e-08 >ref|XP_004300309.1| PREDICTED: casein kinase II subunit beta-like isoform 4 [Fragaria vesca subsp. vesca] Length = 266 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQKP QSYVPRVFGFK+HKP Sbjct: 236 HLFLMTYGHLKPQKPSQSYVPRVFGFKLHKP 266 >ref|XP_004300307.1| PREDICTED: casein kinase II subunit beta-like isoform 2 [Fragaria vesca subsp. vesca] Length = 289 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQKP QSYVPRVFGFK+HKP Sbjct: 259 HLFLMTYGHLKPQKPSQSYVPRVFGFKLHKP 289 >ref|XP_006385581.1| hypothetical protein POPTR_0003s08300g [Populus trichocarpa] gi|118485664|gb|ABK94682.1| unknown [Populus trichocarpa] gi|550342708|gb|ERP63378.1| hypothetical protein POPTR_0003s08300g [Populus trichocarpa] Length = 275 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK VQSYVPRVFGFKIHKP Sbjct: 245 HLFLMTYGHLKPQKVVQSYVPRVFGFKIHKP 275 >gb|EPS57799.1| hypothetical protein M569_17018, partial [Genlisea aurea] Length = 226 Score = 67.4 bits (163), Expect = 3e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQKP QSY+P+VFGFK+HKP Sbjct: 196 HLFLMTYGHLKPQKPTQSYIPKVFGFKLHKP 226 >ref|XP_006375187.1| Casein kinase II beta-3 subunit family protein [Populus trichocarpa] gi|550323506|gb|ERP52984.1| Casein kinase II beta-3 subunit family protein [Populus trichocarpa] Length = 300 Score = 67.0 bits (162), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK +QSYVPRVFGFK+HKP Sbjct: 270 HLFLMTYGHLKPQKAIQSYVPRVFGFKLHKP 300 >gb|EXB38353.1| Putative casein kinase II subunit beta-4 [Morus notabilis] Length = 274 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK QSYVPRVFGFKIHKP Sbjct: 244 HLFLMTYGHLKPQKAAQSYVPRVFGFKIHKP 274 >ref|XP_006477066.1| PREDICTED: casein kinase II subunit beta-like isoform X3 [Citrus sinensis] Length = 283 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK VQSY PRVFGFKIHKP Sbjct: 253 HLFLMTYGHLKPQKAVQSYAPRVFGFKIHKP 283 >ref|XP_006477065.1| PREDICTED: casein kinase II subunit beta-like isoform X2 [Citrus sinensis] Length = 283 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK VQSY PRVFGFKIHKP Sbjct: 253 HLFLMTYGHLKPQKAVQSYAPRVFGFKIHKP 283 >ref|XP_006477064.1| PREDICTED: casein kinase II subunit beta-like isoform X1 [Citrus sinensis] Length = 284 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK VQSY PRVFGFKIHKP Sbjct: 254 HLFLMTYGHLKPQKAVQSYAPRVFGFKIHKP 284 >ref|XP_006440147.1| hypothetical protein CICLE_v10021529mg [Citrus clementina] gi|557542409|gb|ESR53387.1| hypothetical protein CICLE_v10021529mg [Citrus clementina] Length = 283 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK VQSY PRVFGFKIHKP Sbjct: 253 HLFLMTYGHLKPQKAVQSYAPRVFGFKIHKP 283 >ref|XP_006440146.1| hypothetical protein CICLE_v10021529mg [Citrus clementina] gi|557542408|gb|ESR53386.1| hypothetical protein CICLE_v10021529mg [Citrus clementina] Length = 284 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK VQSY PRVFGFKIHKP Sbjct: 254 HLFLMTYGHLKPQKAVQSYAPRVFGFKIHKP 284 >ref|XP_006440145.1| hypothetical protein CICLE_v10021529mg [Citrus clementina] gi|557542407|gb|ESR53385.1| hypothetical protein CICLE_v10021529mg [Citrus clementina] Length = 283 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK VQSY PRVFGFKIHKP Sbjct: 253 HLFLMTYGHLKPQKAVQSYAPRVFGFKIHKP 283 >ref|XP_002269020.1| PREDICTED: putative casein kinase II subunit beta-4 isoform 1 [Vitis vinifera] gi|297734650|emb|CBI16701.3| unnamed protein product [Vitis vinifera] Length = 288 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK QSYVPRVFGFKIHKP Sbjct: 258 HLFLMTYGHLKPQKAAQSYVPRVFGFKIHKP 288 >emb|CAN72327.1| hypothetical protein VITISV_022015 [Vitis vinifera] Length = 282 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK QSYVPRVFGFKIHKP Sbjct: 252 HLFLMTYGHLKPQKAAQSYVPRVFGFKIHKP 282 >ref|XP_006445463.1| hypothetical protein CICLE_v10021491mg [Citrus clementina] gi|557547725|gb|ESR58703.1| hypothetical protein CICLE_v10021491mg [Citrus clementina] Length = 235 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK QSYVPRVFGFK+HKP Sbjct: 205 HLFLMTYGHLKPQKATQSYVPRVFGFKLHKP 235 >ref|XP_006445462.1| hypothetical protein CICLE_v10021491mg [Citrus clementina] gi|568819717|ref|XP_006464392.1| PREDICTED: putative casein kinase II subunit beta-4-like [Citrus sinensis] gi|557547724|gb|ESR58702.1| hypothetical protein CICLE_v10021491mg [Citrus clementina] Length = 288 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK QSYVPRVFGFK+HKP Sbjct: 258 HLFLMTYGHLKPQKATQSYVPRVFGFKLHKP 288 >ref|XP_006414205.1| hypothetical protein EUTSA_v10025930mg [Eutrema salsugineum] gi|557115375|gb|ESQ55658.1| hypothetical protein EUTSA_v10025930mg [Eutrema salsugineum] Length = 283 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK QSYVPRVFGFK+HKP Sbjct: 253 HLFLMTYGHLKPQKAAQSYVPRVFGFKLHKP 283 >ref|XP_006414204.1| hypothetical protein EUTSA_v10025930mg [Eutrema salsugineum] gi|557115374|gb|ESQ55657.1| hypothetical protein EUTSA_v10025930mg [Eutrema salsugineum] Length = 281 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK QSYVPRVFGFK+HKP Sbjct: 251 HLFLMTYGHLKPQKAAQSYVPRVFGFKLHKP 281 >ref|XP_007220529.1| hypothetical protein PRUPE_ppa009433mg [Prunus persica] gi|462416991|gb|EMJ21728.1| hypothetical protein PRUPE_ppa009433mg [Prunus persica] Length = 292 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK QSYVPRVFGFK+HKP Sbjct: 262 HLFLMTYGHLKPQKATQSYVPRVFGFKLHKP 292 >gb|AEK26563.1| casein kinase II beta subunit [Populus tremula] gi|340007717|gb|AEK26564.1| casein kinase II beta subunit [Populus tremula] gi|340007719|gb|AEK26565.1| casein kinase II beta subunit [Populus tremula] Length = 125 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 629 HLFLMTYGHLKPQKPVQSYVPRVFGFKIHKP 537 HLFLMTYGHLKPQK QSYVPRVFGFK+HKP Sbjct: 95 HLFLMTYGHLKPQKATQSYVPRVFGFKLHKP 125