BLASTX nr result
ID: Mentha22_contig00025021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00025021 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46808.1| hypothetical protein MIMGU_mgv1a000875mg [Mimulus... 74 2e-11 >gb|EYU46808.1| hypothetical protein MIMGU_mgv1a000875mg [Mimulus guttatus] Length = 953 Score = 73.9 bits (180), Expect = 2e-11 Identities = 38/66 (57%), Positives = 41/66 (62%) Frame = +2 Query: 122 MRLQKVYHRFSLLHFPKQPLILSHSPHFVSLKPPPRPPFHLIKPFSSTSXXXXXXXXMPI 301 MRL KVY SL H PKQP +LS SPHF+SLKPP R PF IKP S+TS M Sbjct: 1 MRLHKVYQCASLFHLPKQPFLLSSSPHFLSLKPPLRHPFQFIKPCSTTSPAAFPTKPMRS 60 Query: 302 RNIATV 319 RNI V Sbjct: 61 RNIVAV 66