BLASTX nr result
ID: Mentha22_contig00024941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00024941 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67063.1| hypothetical protein VITISV_017540 [Vitis vinifera] 56 6e-06 >emb|CAN67063.1| hypothetical protein VITISV_017540 [Vitis vinifera] Length = 151 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +2 Query: 5 KQILCEILSGLLNPTSEYLYVKKLRIFVFQNPDHQANHGCRSLKL 139 K L +IL+GLLNPTS LYVKK + FVFQNPDHQ+ C +L L Sbjct: 84 KSTLLKILAGLLNPTSGTLYVKKPKSFVFQNPDHQSYEICMTLWL 128