BLASTX nr result
ID: Mentha22_contig00024910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00024910 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39678.1| hypothetical protein MIMGU_mgv1a003888mg [Mimulus... 56 5e-06 >gb|EYU39678.1| hypothetical protein MIMGU_mgv1a003888mg [Mimulus guttatus] Length = 557 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -2 Query: 369 LAGMSSHASQRATTRGSLVAGAAPPADSFSFGAM 268 L+GMSSH +QRATT+G LVAGAAPPA++FSFG + Sbjct: 483 LSGMSSHRTQRATTKGKLVAGAAPPAENFSFGGV 516