BLASTX nr result
ID: Mentha22_contig00024836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00024836 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007288351.1| hypothetical protein MBM_00462 [Marssonina b... 75 9e-12 emb|CCU77229.1| hypothetical protein BGHDH14_bgh03188 [Blumeria ... 73 5e-11 gb|EPQ64031.1| hypothetical protein BGT96224_3286 [Blumeria gram... 72 6e-11 gb|ESZ91894.1| hypothetical protein SBOR_7724 [Sclerotinia borea... 69 7e-10 ref|XP_001550063.1| hypothetical protein BC1G_11129 [Botryotinia... 69 7e-10 ref|XP_001588638.1| hypothetical protein SS1G_10185 [Sclerotinia... 69 9e-10 ref|XP_003709339.1| hypothetical protein MGG_06638 [Magnaporthe ... 64 3e-08 gb|EPE29451.1| hypothetical protein GLAREA_00611 [Glarea lozoyen... 62 6e-08 gb|EJT69993.1| hypothetical protein GGTG_12170 [Gaeumannomyces g... 62 1e-07 ref|XP_001225600.1| hypothetical protein CHGG_07944 [Chaetomium ... 60 2e-07 gb|ERS96300.1| hypothetical protein HMPREF1624_07209 [Sporothrix... 59 5e-07 ref|XP_003657701.1| hypothetical protein THITE_2171573 [Thielavi... 59 7e-07 ref|XP_003666851.1| hypothetical protein MYCTH_2084695 [Myceliop... 59 9e-07 gb|EPE06248.1| hypothetical protein F503_02376 [Ophiostoma picea... 58 1e-06 ref|XP_007600014.1| hypothetical protein CFIO01_13035 [Colletotr... 57 3e-06 emb|CCF40433.1| hypothetical protein CH063_11008 [Colletotrichum... 57 3e-06 gb|EFQ33439.1| hypothetical protein GLRG_08718 [Colletotrichum g... 57 3e-06 gb|ETS73357.1| hypothetical protein PFICI_14962 [Pestalotiopsis ... 56 5e-06 gb|ELR07614.1| hypothetical protein GMDG_02662 [Pseudogymnoascus... 56 5e-06 gb|EGY20369.1| hypothetical protein VDAG_09998 [Verticillium dah... 56 6e-06 >ref|XP_007288351.1| hypothetical protein MBM_00462 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406868312|gb|EKD21349.1| hypothetical protein MBM_00462 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 161 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYED 133 MTFDMDWS +FCL CDRQTDGNVYCSE+CRLAEYE+ Sbjct: 1 MTFDMDWSPAFCLACDRQTDGNVYCSESCRLAEYEN 36 >emb|CCU77229.1| hypothetical protein BGHDH14_bgh03188 [Blumeria graminis f. sp. hordei DH14] Length = 163 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 MT D+DWSHSFCL CDRQTDG+VYCSE+CRLAEYE Sbjct: 1 MTNDIDWSHSFCLACDRQTDGDVYCSESCRLAEYE 35 >gb|EPQ64031.1| hypothetical protein BGT96224_3286 [Blumeria graminis f. sp. tritici 96224] Length = 163 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 MT D+DWSHSFCL CDRQTDG+VYCSE CRLAEYE Sbjct: 1 MTNDIDWSHSFCLACDRQTDGDVYCSEACRLAEYE 35 >gb|ESZ91894.1| hypothetical protein SBOR_7724 [Sclerotinia borealis F-4157] Length = 153 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 M+FDM+WS FCL CDRQTDG+VYCSE CRLAEYE Sbjct: 1 MSFDMEWSPDFCLACDRQTDGSVYCSEACRLAEYE 35 >ref|XP_001550063.1| hypothetical protein BC1G_11129 [Botryotinia fuckeliana B05.10] gi|347835950|emb|CCD50522.1| hypothetical protein BofuT4_P089210.1 [Botryotinia fuckeliana T4] gi|472246575|gb|EMR91107.1| hypothetical protein BcDW1_210 [Botryotinia fuckeliana BcDW1] Length = 154 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 M+FDM+WS FCL CDRQTDG+VYCSE CRLAEYE Sbjct: 1 MSFDMEWSPDFCLACDRQTDGSVYCSEACRLAEYE 35 >ref|XP_001588638.1| hypothetical protein SS1G_10185 [Sclerotinia sclerotiorum 1980] gi|154694574|gb|EDN94312.1| hypothetical protein SS1G_10185 [Sclerotinia sclerotiorum 1980 UF-70] Length = 156 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 M+FDM+WS FCL CDRQTDG VYCSE CRLAEYE Sbjct: 1 MSFDMEWSPEFCLACDRQTDGGVYCSEACRLAEYE 35 >ref|XP_003709339.1| hypothetical protein MGG_06638 [Magnaporthe oryzae 70-15] gi|351648868|gb|EHA56727.1| hypothetical protein MGG_06638 [Magnaporthe oryzae 70-15] gi|440472587|gb|ELQ41440.1| hypothetical protein OOU_Y34scaffold00278g8 [Magnaporthe oryzae Y34] gi|440487208|gb|ELQ67012.1| hypothetical protein OOW_P131scaffold00343g23 [Magnaporthe oryzae P131] Length = 153 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 M F++ W H FCL CDRQTDG YCSE+CRLA+YE Sbjct: 1 MAFEIQWDHQFCLACDRQTDGATYCSESCRLADYE 35 >gb|EPE29451.1| hypothetical protein GLAREA_00611 [Glarea lozoyensis ATCC 20868] Length = 160 Score = 62.4 bits (150), Expect = 6e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 228 MDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 MDWS FCL CD+QTDG VYCSE+CRLAEYE Sbjct: 5 MDWSPDFCLACDKQTDGRVYCSESCRLAEYE 35 >gb|EJT69993.1| hypothetical protein GGTG_12170 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 143 Score = 61.6 bits (148), Expect = 1e-07 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 M D+ W H FCL CD+QTDG YCSE+CRLA+YE Sbjct: 1 MALDIQWDHQFCLACDKQTDGATYCSESCRLADYE 35 >ref|XP_001225600.1| hypothetical protein CHGG_07944 [Chaetomium globosum CBS 148.51] gi|88179223|gb|EAQ86691.1| hypothetical protein CHGG_07944 [Chaetomium globosum CBS 148.51] Length = 242 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -1 Query: 249 TYIMTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 T +M+FD W H FCL CD+QTDG YCSE+CRLA+YE Sbjct: 97 TTVMSFD--WEHQFCLGCDKQTDGATYCSESCRLADYE 132 >gb|ERS96300.1| hypothetical protein HMPREF1624_07209 [Sporothrix schenckii ATCC 58251] Length = 231 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 M D+ W H FCL CD+QTDG YCSE+CRLA+YE Sbjct: 1 MANDLMWDHHFCLTCDKQTDGPAYCSESCRLADYE 35 >ref|XP_003657701.1| hypothetical protein THITE_2171573 [Thielavia terrestris NRRL 8126] gi|347004967|gb|AEO71365.1| hypothetical protein THITE_2171573 [Thielavia terrestris NRRL 8126] Length = 150 Score = 58.9 bits (141), Expect = 7e-07 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -1 Query: 225 DWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 DW+H FCL CD+QTDG YCSE+CRLA+YE Sbjct: 4 DWTHQFCLGCDKQTDGATYCSESCRLADYE 33 >ref|XP_003666851.1| hypothetical protein MYCTH_2084695 [Myceliophthora thermophila ATCC 42464] gi|347014124|gb|AEO61606.1| hypothetical protein MYCTH_2084695 [Myceliophthora thermophila ATCC 42464] Length = 252 Score = 58.5 bits (140), Expect = 9e-07 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 225 DWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 DW H FCL CD+QTDG YCSE+CRLA+YE Sbjct: 105 DWEHQFCLGCDKQTDGATYCSESCRLADYE 134 >gb|EPE06248.1| hypothetical protein F503_02376 [Ophiostoma piceae UAMH 11346] Length = 213 Score = 58.2 bits (139), Expect = 1e-06 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYED 133 M ++ W H +CL CD+QTDG YCSE+CRLA+YE+ Sbjct: 1 MASELQWVHQYCLTCDQQTDGATYCSESCRLADYEE 36 >ref|XP_007600014.1| hypothetical protein CFIO01_13035 [Colletotrichum fioriniae PJ7] gi|588894354|gb|EXF76345.1| hypothetical protein CFIO01_13035 [Colletotrichum fioriniae PJ7] Length = 154 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 234 FDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 FD+ W+H FCL CD+QTDG YCSE+CRLA++E Sbjct: 4 FDL-WTHEFCLGCDKQTDGTAYCSESCRLADFE 35 >emb|CCF40433.1| hypothetical protein CH063_11008 [Colletotrichum higginsianum] Length = 152 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 234 FDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 FD+ W+H FCL CD+QTDG YCSE+CRLA++E Sbjct: 4 FDL-WTHEFCLGCDKQTDGTAYCSESCRLADFE 35 >gb|EFQ33439.1| hypothetical protein GLRG_08718 [Colletotrichum graminicola M1.001] Length = 152 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 234 FDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 FD+ W+H FCL CD+QTDG YCSE+CRLA++E Sbjct: 4 FDL-WTHEFCLGCDKQTDGTAYCSESCRLADFE 35 >gb|ETS73357.1| hypothetical protein PFICI_14962 [Pestalotiopsis fici W106-1] Length = 157 Score = 56.2 bits (134), Expect = 5e-06 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 M+ + W H FCL CDRQTDG YCSE+CRL++++ Sbjct: 1 MSGSLSWDHQFCLACDRQTDGATYCSESCRLSDFD 35 >gb|ELR07614.1| hypothetical protein GMDG_02662 [Pseudogymnoascus destructans 20631-21] Length = 153 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -1 Query: 240 MTFDMDWSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 M ++DWS S+CL CDRQT + YCSE+CRLAEYE Sbjct: 1 MAQEIDWSPSYCLACDRQTYTSAYCSESCRLAEYE 35 >gb|EGY20369.1| hypothetical protein VDAG_09998 [Verticillium dahliae VdLs.17] Length = 150 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/29 (68%), Positives = 25/29 (86%) Frame = -1 Query: 222 WSHSFCLMCDRQTDGNVYCSETCRLAEYE 136 W+H FCL CD+QTDG YCSE+CRLA++E Sbjct: 5 WAHEFCLGCDKQTDGTAYCSESCRLADFE 33