BLASTX nr result
ID: Mentha22_contig00024795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00024795 (561 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45373.1| hypothetical protein MIMGU_mgv1a007634mg [Mimulus... 59 7e-07 gb|EPS69076.1| hypothetical protein M569_05696, partial [Genlise... 57 3e-06 >gb|EYU45373.1| hypothetical protein MIMGU_mgv1a007634mg [Mimulus guttatus] Length = 401 Score = 59.3 bits (142), Expect = 7e-07 Identities = 32/55 (58%), Positives = 35/55 (63%), Gaps = 18/55 (32%) Frame = -1 Query: 111 GMLPPFGVESEETRAMARHST------------------PVFCPSLLAEMIRPDG 1 GMLPPFGVESEETR+MA+H T PVF PS+LAEMIRPDG Sbjct: 110 GMLPPFGVESEETRSMAKHLTVGIEPRISSERIILLDTQPVFSPSVLAEMIRPDG 164 >gb|EPS69076.1| hypothetical protein M569_05696, partial [Genlisea aurea] Length = 210 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/55 (52%), Positives = 35/55 (63%), Gaps = 18/55 (32%) Frame = -1 Query: 111 GMLPPFGVESEETRAMARHST------------------PVFCPSLLAEMIRPDG 1 GMLPPFG++SEETRAMA+H T PVF PS+LAE++RPDG Sbjct: 100 GMLPPFGIQSEETRAMAKHLTVGIEPRISRERIILLDTQPVFSPSVLAEIVRPDG 154