BLASTX nr result
ID: Mentha22_contig00024323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00024323 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38554.1| hypothetical protein MIMGU_mgv1a022732mg, partial... 82 6e-14 >gb|EYU38554.1| hypothetical protein MIMGU_mgv1a022732mg, partial [Mimulus guttatus] Length = 734 Score = 82.4 bits (202), Expect = 6e-14 Identities = 47/94 (50%), Positives = 62/94 (65%), Gaps = 1/94 (1%) Frame = -1 Query: 281 TVACDIPVSNVNTSRYCDNTAVVLSPRRESRDLTHTRQVVNTMDMTLASGEWVDSLMNIS 102 +V + VSN+N SRY D+TAV+ S S DL NT DM ++GEW D+L N+S Sbjct: 456 SVQSGVSVSNINNSRYRDSTAVLSSIGEASEDLAPE----NT-DMAFSAGEWADTLTNVS 510 Query: 101 MGELLSESTPNTDANCSDFPGALASNS-QQIPFS 3 MG+LLS+S N DANC+DF L+SN QQ+PF+ Sbjct: 511 MGDLLSDSHNNADANCTDFSLPLSSNCLQQMPFT 544