BLASTX nr result
ID: Mentha22_contig00024280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00024280 (771 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19159.1| hypothetical protein MIMGU_mgv1a009060mg [Mimulus... 79 2e-12 ref|XP_006370335.1| hypothetical protein POPTR_0001s41750g [Popu... 76 2e-11 gb|EXB89646.1| Cytochrome c-type biogenesis ccda-like chloroplas... 75 2e-11 ref|XP_007021268.1| Cytochrome c-type biogenesis ccda chloroplas... 75 2e-11 ref|XP_002531046.1| Thiol:disulfide interchange protein dsbD pre... 75 2e-11 gb|AAO16018.1| chloroplast biogenesis protein [Lotus japonicus] 75 2e-11 ref|XP_004149294.1| PREDICTED: cytochrome c-type biogenesis ccda... 75 3e-11 ref|XP_006464679.1| PREDICTED: cytochrome c-type biogenesis ccda... 75 3e-11 ref|XP_006451992.1| hypothetical protein CICLE_v10009149mg [Citr... 75 3e-11 ref|XP_006451991.1| hypothetical protein CICLE_v10009149mg [Citr... 75 3e-11 ref|XP_006857711.1| hypothetical protein AMTR_s00061p00174500 [A... 75 3e-11 ref|XP_003578956.1| PREDICTED: cytochrome c-type biogenesis ccda... 75 3e-11 ref|XP_006591900.1| PREDICTED: cytochrome c-type biogenesis ccda... 74 4e-11 ref|XP_007133142.1| hypothetical protein PHAVU_011G155100g [Phas... 74 4e-11 ref|XP_004516451.1| PREDICTED: cytochrome c-type biogenesis ccda... 74 4e-11 ref|XP_004516450.1| PREDICTED: cytochrome c-type biogenesis ccda... 74 4e-11 ref|XP_004294507.1| PREDICTED: cytochrome c-type biogenesis ccda... 74 4e-11 sp|Q2QY07.1|CCDA2_ORYSJ RecName: Full=Cytochrome c-type biogenes... 74 4e-11 gb|ABA95764.1| Cytochrome C biogenesis protein transmembrane reg... 74 4e-11 sp|Q2RAR6.1|CCDA1_ORYSJ RecName: Full=Cytochrome c-type biogenes... 74 4e-11 >gb|EYU19159.1| hypothetical protein MIMGU_mgv1a009060mg [Mimulus guttatus] Length = 354 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTE+ Sbjct: 135 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEV 173 >ref|XP_006370335.1| hypothetical protein POPTR_0001s41750g [Populus trichocarpa] gi|550349514|gb|ERP66904.1| hypothetical protein POPTR_0001s41750g [Populus trichocarpa] Length = 317 Score = 75.9 bits (185), Expect = 2e-11 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ EI Sbjct: 98 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAEI 136 >gb|EXB89646.1| Cytochrome c-type biogenesis ccda-like chloroplastic protein 2 [Morus notabilis] Length = 347 Score = 75.5 bits (184), Expect = 2e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ E+ Sbjct: 127 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAEV 165 >ref|XP_007021268.1| Cytochrome c-type biogenesis ccda chloroplastic protein isoform 1 [Theobroma cacao] gi|508720896|gb|EOY12793.1| Cytochrome c-type biogenesis ccda chloroplastic protein isoform 1 [Theobroma cacao] Length = 347 Score = 75.5 bits (184), Expect = 2e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLT+GYIGAFGSGK +TEI Sbjct: 128 AVIFGAGLVTSLSPCTLSVLPLTIGYIGAFGSGKGRTEI 166 >ref|XP_002531046.1| Thiol:disulfide interchange protein dsbD precursor, putative [Ricinus communis] gi|223529374|gb|EEF31339.1| Thiol:disulfide interchange protein dsbD precursor, putative [Ricinus communis] Length = 350 Score = 75.5 bits (184), Expect = 2e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ E+ Sbjct: 131 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAEV 169 >gb|AAO16018.1| chloroplast biogenesis protein [Lotus japonicus] Length = 345 Score = 75.5 bits (184), Expect = 2e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ E+ Sbjct: 125 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAEV 163 >ref|XP_004149294.1| PREDICTED: cytochrome c-type biogenesis ccda-like chloroplastic protein 2-like [Cucumis sativus] gi|449528927|ref|XP_004171453.1| PREDICTED: cytochrome c-type biogenesis ccda-like chloroplastic protein 2-like [Cucumis sativus] Length = 362 Score = 75.1 bits (183), Expect = 3e-11 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAG VTSLSPCTLSVLPLTLGYIGAFGSGKSK E+ Sbjct: 143 AVIFGAGFVTSLSPCTLSVLPLTLGYIGAFGSGKSKAEV 181 >ref|XP_006464679.1| PREDICTED: cytochrome c-type biogenesis ccda-like chloroplastic protein-like isoform X1 [Citrus sinensis] gi|568820340|ref|XP_006464680.1| PREDICTED: cytochrome c-type biogenesis ccda-like chloroplastic protein-like isoform X2 [Citrus sinensis] Length = 341 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ +I Sbjct: 122 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAQI 160 >ref|XP_006451992.1| hypothetical protein CICLE_v10009149mg [Citrus clementina] gi|557555218|gb|ESR65232.1| hypothetical protein CICLE_v10009149mg [Citrus clementina] Length = 270 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ +I Sbjct: 51 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAQI 89 >ref|XP_006451991.1| hypothetical protein CICLE_v10009149mg [Citrus clementina] gi|568820342|ref|XP_006464681.1| PREDICTED: cytochrome c-type biogenesis ccda-like chloroplastic protein-like isoform X3 [Citrus sinensis] gi|557555217|gb|ESR65231.1| hypothetical protein CICLE_v10009149mg [Citrus clementina] Length = 277 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ +I Sbjct: 58 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAQI 96 >ref|XP_006857711.1| hypothetical protein AMTR_s00061p00174500 [Amborella trichopoda] gi|548861807|gb|ERN19178.1| hypothetical protein AMTR_s00061p00174500 [Amborella trichopoda] Length = 356 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ +I Sbjct: 136 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAQI 174 >ref|XP_003578956.1| PREDICTED: cytochrome c-type biogenesis ccda-like chloroplastic protein 2-like [Brachypodium distachyon] Length = 348 Score = 74.7 bits (182), Expect = 3e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFG+GK +TE+ Sbjct: 128 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGAGKDRTEV 166 >ref|XP_006591900.1| PREDICTED: cytochrome c-type biogenesis ccda-like chloroplastic protein 2-like isoform X2 [Glycine max] Length = 319 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVI+GAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ E+ Sbjct: 125 AVIYGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAEV 163 >ref|XP_007133142.1| hypothetical protein PHAVU_011G155100g [Phaseolus vulgaris] gi|561006142|gb|ESW05136.1| hypothetical protein PHAVU_011G155100g [Phaseolus vulgaris] Length = 345 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVI+GAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ E+ Sbjct: 125 AVIYGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAEV 163 >ref|XP_004516451.1| PREDICTED: cytochrome c-type biogenesis ccda-like chloroplastic protein 1-like isoform X2 [Cicer arietinum] Length = 347 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVI+GAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ E+ Sbjct: 128 AVIYGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAEV 166 >ref|XP_004516450.1| PREDICTED: cytochrome c-type biogenesis ccda-like chloroplastic protein 1-like isoform X1 [Cicer arietinum] Length = 348 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVI+GAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ E+ Sbjct: 129 AVIYGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAEV 167 >ref|XP_004294507.1| PREDICTED: cytochrome c-type biogenesis ccda-like chloroplastic protein 2-like [Fragaria vesca subsp. vesca] Length = 360 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKS+ ++ Sbjct: 140 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSRAQV 178 >sp|Q2QY07.1|CCDA2_ORYSJ RecName: Full=Cytochrome c-type biogenesis ccda-like chloroplastic protein 2; AltName: Full=Cytochrome b6f biogenesis protein CCDA2; Flags: Precursor gi|77552967|gb|ABA95763.1| Cytochrome C biogenesis protein transmembrane region containing protein, expressed [Oryza sativa Japonica Group] Length = 362 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGK ++E+ Sbjct: 142 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKDRSEV 180 >gb|ABA95764.1| Cytochrome C biogenesis protein transmembrane region containing protein, expressed [Oryza sativa Japonica Group] Length = 245 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGK ++E+ Sbjct: 142 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKDRSEV 180 >sp|Q2RAR6.1|CCDA1_ORYSJ RecName: Full=Cytochrome c-type biogenesis ccda-like chloroplastic protein 1; AltName: Full=Cytochrome b6f biogenesis protein CCDA1; Flags: Precursor gi|77548619|gb|ABA91416.1| Cytochrome C biogenesis protein transmembrane region containing protein, expressed [Oryza sativa Japonica Group] gi|215769034|dbj|BAH01263.1| unnamed protein product [Oryza sativa Japonica Group] Length = 367 Score = 74.3 bits (181), Expect = 4e-11 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -1 Query: 231 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKSKTEI 115 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGK ++E+ Sbjct: 147 AVIFGAGLVTSLSPCTLSVLPLTLGYIGAFGSGKDRSEV 185