BLASTX nr result
ID: Mentha22_contig00024278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00024278 (615 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39864.1| hypothetical protein MIMGU_mgv1a003855mg [Mimulus... 42 1e-07 >gb|EYU39864.1| hypothetical protein MIMGU_mgv1a003855mg [Mimulus guttatus] Length = 559 Score = 42.4 bits (98), Expect(2) = 1e-07 Identities = 22/35 (62%), Positives = 28/35 (80%), Gaps = 4/35 (11%) Frame = -3 Query: 523 MKNSVSEQSFYIESEKEED----VAGRVEDDEAGH 431 MKNSVSEQSFYI+SE+EED + +VED+EA + Sbjct: 1 MKNSVSEQSFYIDSEEEEDEEKVLYDKVEDNEAAN 35 Score = 39.7 bits (91), Expect(2) = 1e-07 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 350 QSKPNSLNPSWPQSYR 303 QSKPNSLNPSWPQSYR Sbjct: 53 QSKPNSLNPSWPQSYR 68