BLASTX nr result
ID: Mentha22_contig00024052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00024052 (495 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tab... 98 1e-18 gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hi... 97 2e-18 gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 96 7e-18 ref|XP_007028795.1| Calcium-dependent protein kinase 19 [Theobro... 95 1e-17 dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas] 94 3e-17 gb|EYU18750.1| hypothetical protein MIMGU_mgv1a004372mg [Mimulus... 93 4e-17 ref|XP_006489930.1| PREDICTED: calcium-dependent protein kinase ... 93 4e-17 ref|XP_006489929.1| PREDICTED: calcium-dependent protein kinase ... 93 4e-17 ref|XP_006421421.1| hypothetical protein CICLE_v10004707mg [Citr... 93 4e-17 gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasilien... 93 4e-17 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 92 1e-16 gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] 91 2e-16 ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-depe... 91 2e-16 ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase ... 91 2e-16 ref|XP_002529620.1| calcium-dependent protein kinase, putative [... 91 2e-16 gb|AFK48659.1| unknown [Medicago truncatula] 90 3e-16 gb|AGG35977.1| calcium-dependent protein kinase 8, partial [Bras... 89 6e-16 ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase ... 89 6e-16 gb|AFV29350.1| calcium-dependent protein kinase-like protein, pa... 89 6e-16 gb|AFV29312.1| calcium-dependent protein kinase-like protein, pa... 89 6e-16 >gb|ADO79931.1| calcium-dependent protein kinase 8 [Nicotiana tabacum] Length = 530 Score = 98.2 bits (243), Expect = 1e-18 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISYDEF+ MMK+GTDWRKASRQYSRERYNSLSLKL +DGSLQM+NETR Sbjct: 479 KDGRISYDEFSTMMKTGTDWRKASRQYSRERYNSLSLKLMKDGSLQMSNETR 530 >gb|ACX37460.1| calcium dependent protein kinase 32 [Gossypium hirsutum] Length = 550 Score = 97.1 bits (240), Expect = 2e-18 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISYDEFA+MMK+GTDWRKASRQYSRER+N+LSLKL +DGSLQMNNE R Sbjct: 484 KDGRISYDEFAVMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQMNNEPR 535 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 95.5 bits (236), Expect = 7e-18 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISYDEFA MMK+GTDWRKASRQYSRER+N+LSLKL DGSLQMNNE R Sbjct: 483 KDGRISYDEFAAMMKAGTDWRKASRQYSRERFNNLSLKLMRDGSLQMNNEGR 534 >ref|XP_007028795.1| Calcium-dependent protein kinase 19 [Theobroma cacao] gi|508717400|gb|EOY09297.1| Calcium-dependent protein kinase 19 [Theobroma cacao] Length = 533 Score = 94.7 bits (234), Expect = 1e-17 Identities = 45/52 (86%), Positives = 47/52 (90%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISYDEFA MMK+GTDWRKASRQYSRER+NSLSLKL DGSLQ NNE R Sbjct: 482 KDGRISYDEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQSNNEPR 533 >dbj|BAJ53260.1| JMS10C05.3 [Jatropha curcas] Length = 531 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/52 (82%), Positives = 49/52 (94%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISYDEFA MMK+GTDWRKASRQYSRER+++LSLKL +DGSLQ+NNE R Sbjct: 480 KDGRISYDEFATMMKAGTDWRKASRQYSRERFSNLSLKLMKDGSLQLNNEVR 531 >gb|EYU18750.1| hypothetical protein MIMGU_mgv1a004372mg [Mimulus guttatus] Length = 530 Score = 92.8 bits (229), Expect = 4e-17 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNE 152 KDGRIS++EFA MMKSGTDWRKASRQYSRERYNSLSLKL DGSLQM+NE Sbjct: 480 KDGRISFEEFAAMMKSGTDWRKASRQYSRERYNSLSLKLMTDGSLQMSNE 529 >ref|XP_006489930.1| PREDICTED: calcium-dependent protein kinase 32-like isoform X2 [Citrus sinensis] Length = 532 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISY+EFA+MMK+GTDWRKASRQYSRER+NSLSLKL +DGSLQ NN R Sbjct: 481 KDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQSNNNVR 532 >ref|XP_006489929.1| PREDICTED: calcium-dependent protein kinase 32-like isoform X1 [Citrus sinensis] Length = 536 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISY+EFA+MMK+GTDWRKASRQYSRER+NSLSLKL +DGSLQ NN R Sbjct: 485 KDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQSNNNVR 536 >ref|XP_006421421.1| hypothetical protein CICLE_v10004707mg [Citrus clementina] gi|557523294|gb|ESR34661.1| hypothetical protein CICLE_v10004707mg [Citrus clementina] Length = 532 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISY+EFA+MMK+GTDWRKASRQYSRER+NSLSLKL +DGSLQ NN R Sbjct: 481 KDGRISYEEFAVMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQSNNNVR 532 >gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasiliensis] Length = 530 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNN 149 KDGRISYDEFA MMK+GTDWRKASRQYSRER+N+LSLKL +DGSLQMNN Sbjct: 480 KDGRISYDEFATMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQMNN 528 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISY+EFA MMK+GTDWRKASRQYSRER+NSLSLKL DGSLQ+ NE R Sbjct: 481 KDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLTNEGR 532 >gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNE 152 KDGRISY+EFA MMK+GTDWRKASRQYSRER+NSLSLKL DGSLQ+ NE Sbjct: 481 KDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLTNE 530 >ref|XP_004154632.1| PREDICTED: LOW QUALITY PROTEIN: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 530 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISY+EFA MMK+GTDWRKASRQYSRER+NSLSLKL DGSL + NE R Sbjct: 479 KDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLHLTNEAR 530 >ref|XP_004139037.1| PREDICTED: calcium-dependent protein kinase 8-like [Cucumis sativus] Length = 531 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/52 (80%), Positives = 46/52 (88%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISY+EFA MMK+GTDWRKASRQYSRER+NSLSLKL DGSL + NE R Sbjct: 480 KDGRISYEEFAAMMKAGTDWRKASRQYSRERFNSLSLKLMRDGSLHLTNEAR 531 >ref|XP_002529620.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223530905|gb|EEF32765.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 529 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMN 146 KDGRISYDEFA MMK+GTDWRKASRQYSRER+N+LSLKL +DGSLQMN Sbjct: 479 KDGRISYDEFATMMKAGTDWRKASRQYSRERFNNLSLKLMKDGSLQMN 526 >gb|AFK48659.1| unknown [Medicago truncatula] Length = 104 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/50 (82%), Positives = 48/50 (96%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNE 152 KDG+ISY+EFA MMK+GTDWRKASRQYSRER+NSLSLKL +DGSLQ+NN+ Sbjct: 54 KDGKISYEEFANMMKAGTDWRKASRQYSRERFNSLSLKLMKDGSLQLNND 103 >gb|AGG35977.1| calcium-dependent protein kinase 8, partial [Brassica napus] Length = 534 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNET 155 KDGRISY+EFA MM++GTDWRKASRQYSRER+NSLSLKL DGSLQ+ ET Sbjct: 484 KDGRISYEEFAAMMRAGTDWRKASRQYSRERFNSLSLKLMRDGSLQLEGET 534 >ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase 8-like [Fragaria vesca subsp. vesca] Length = 532 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISY+EF MMKSGTDWRKASRQYSRER+NS+SLKL +GSLQ+ NE R Sbjct: 481 KDGRISYEEFVAMMKSGTDWRKASRQYSRERFNSISLKLMREGSLQLTNEGR 532 >gb|AFV29350.1| calcium-dependent protein kinase-like protein, partial [Senecio vulgaris] Length = 145 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISY+EFA MMKSGTDWRKASRQYSRER+N+LSLKL +DGSL++ NE + Sbjct: 94 KDGRISYEEFATMMKSGTDWRKASRQYSRERFNNLSLKLMKDGSLELVNEDK 145 >gb|AFV29312.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188907|gb|AFV29313.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188913|gb|AFV29316.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188915|gb|AFV29317.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188917|gb|AFV29318.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188919|gb|AFV29319.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188921|gb|AFV29320.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188923|gb|AFV29321.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188925|gb|AFV29322.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188927|gb|AFV29323.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188933|gb|AFV29326.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188935|gb|AFV29327.1| calcium-dependent protein kinase-like protein, partial [Senecio chrysanthemifolius] gi|409188953|gb|AFV29336.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188955|gb|AFV29337.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] gi|409188961|gb|AFV29340.1| calcium-dependent protein kinase-like protein, partial [Senecio aethnensis x Senecio chrysanthemifolius] Length = 145 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/52 (78%), Positives = 48/52 (92%) Frame = +3 Query: 3 KDGRISYDEFALMMKSGTDWRKASRQYSRERYNSLSLKLFEDGSLQMNNETR 158 KDGRISY+EFA MMKSGTDWRKASRQYSRER+N+LSLKL +DGSL++ NE + Sbjct: 94 KDGRISYEEFATMMKSGTDWRKASRQYSRERFNNLSLKLMKDGSLELVNEDK 145