BLASTX nr result
ID: Mentha22_contig00023952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00023952 (593 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004230951.1| PREDICTED: protein winged eye-like [Solanum ... 116 4e-24 emb|CBI38025.3| unnamed protein product [Vitis vinifera] 114 2e-23 ref|XP_002263493.1| PREDICTED: chromatin structure-remodeling co... 114 2e-23 ref|XP_004289655.1| PREDICTED: BAH and coiled-coil domain-contai... 113 5e-23 ref|XP_003603985.1| Ebs-bah-phd domain-containing protein [Medic... 111 2e-22 ref|NP_001236094.1| uncharacterized protein LOC100526926 [Glycin... 110 3e-22 gb|EYU37830.1| hypothetical protein MIMGU_mgv1a013467mg [Mimulus... 109 7e-22 ref|XP_007042081.1| PHD finger family protein / bromo-adjacent d... 109 7e-22 ref|XP_007135939.1| hypothetical protein PHAVU_009G004500g [Phas... 108 9e-22 ref|XP_006362024.1| PREDICTED: protein winged eye-like [Solanum ... 108 1e-21 ref|XP_007200462.1| hypothetical protein PRUPE_ppa011301mg [Prun... 108 1e-21 ref|XP_003527148.1| PREDICTED: BAH and coiled-coil domain-contai... 108 1e-21 ref|XP_002512960.1| phd finger transcription factor, putative [R... 108 1e-21 ref|XP_006423394.1| hypothetical protein CICLE_v10029260mg [Citr... 106 4e-21 ref|XP_004500782.1| PREDICTED: protein polybromo-1-like [Cicer a... 106 4e-21 ref|XP_004148528.1| PREDICTED: BAH and coiled-coil domain-contai... 106 6e-21 ref|XP_002305450.1| SHORT LIFE family protein [Populus trichocar... 106 6e-21 gb|EYU42596.1| hypothetical protein MIMGU_mgv1a013749mg [Mimulus... 105 7e-21 ref|XP_007042082.1| PHD finger family protein / bromo-adjacent d... 103 5e-20 ref|XP_007200463.1| hypothetical protein PRUPE_ppa011301mg [Prun... 102 8e-20 >ref|XP_004230951.1| PREDICTED: protein winged eye-like [Solanum lycopersicum] Length = 216 Score = 116 bits (291), Expect = 4e-24 Identities = 48/67 (71%), Positives = 60/67 (89%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGCSDWFHPTCIDM+PEEA+ L+HF+C NC+ E++KKL NS ++R A Sbjct: 146 MPYNPDDLMVQCEGCSDWFHPTCIDMTPEEAKRLDHFFCQNCSSEDQKKLLNSHATSRHA 205 Query: 412 DVKVDTK 392 D+KV++K Sbjct: 206 DIKVESK 212 >emb|CBI38025.3| unnamed protein product [Vitis vinifera] Length = 215 Score = 114 bits (285), Expect = 2e-23 Identities = 48/67 (71%), Positives = 58/67 (86%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGC+DWFHP CIDM+PEEA+ LEHF+C NC+ E++KKL NS ++R + Sbjct: 145 MPYNPDDLMVQCEGCTDWFHPACIDMTPEEAKRLEHFFCQNCSSEDQKKLLNSHNASRHS 204 Query: 412 DVKVDTK 392 D KVDTK Sbjct: 205 DAKVDTK 211 >ref|XP_002263493.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like [Vitis vinifera] Length = 224 Score = 114 bits (285), Expect = 2e-23 Identities = 48/67 (71%), Positives = 58/67 (86%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGC+DWFHP CIDM+PEEA+ LEHF+C NC+ E++KKL NS ++R + Sbjct: 154 MPYNPDDLMVQCEGCTDWFHPACIDMTPEEAKRLEHFFCQNCSSEDQKKLLNSHNASRHS 213 Query: 412 DVKVDTK 392 D KVDTK Sbjct: 214 DAKVDTK 220 >ref|XP_004289655.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 216 Score = 113 bits (282), Expect = 5e-23 Identities = 48/67 (71%), Positives = 55/67 (82%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGC+DWFHP CIDMS EEAE LEHF+C +C+PE +KKL NS +R Sbjct: 146 MPYNPDDLMVQCEGCNDWFHPACIDMSAEEAERLEHFFCESCSPEGQKKLENSHTVSRQL 205 Query: 412 DVKVDTK 392 D KV+TK Sbjct: 206 DTKVETK 212 >ref|XP_003603985.1| Ebs-bah-phd domain-containing protein [Medicago truncatula] gi|355493033|gb|AES74236.1| Ebs-bah-phd domain-containing protein [Medicago truncatula] gi|388498190|gb|AFK37161.1| unknown [Medicago truncatula] Length = 218 Score = 111 bits (277), Expect = 2e-22 Identities = 48/67 (71%), Positives = 56/67 (83%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGCSDWFHP CIDM+ EEAE L+HF+C +C+ E +K+L NS +TR A Sbjct: 148 MPYNPDDLMVQCEGCSDWFHPACIDMTVEEAERLDHFFCESCSVEGQKQLQNSHSATRLA 207 Query: 412 DVKVDTK 392 D KVDTK Sbjct: 208 DTKVDTK 214 >ref|NP_001236094.1| uncharacterized protein LOC100526926 [Glycine max] gi|255631163|gb|ACU15947.1| unknown [Glycine max] Length = 216 Score = 110 bits (275), Expect = 3e-22 Identities = 46/67 (68%), Positives = 56/67 (83%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGC+DWFHP CIDM+ EEA+ L+HF+C NC+ E +KKL NS ++R + Sbjct: 146 MPYNPDDLMVQCEGCTDWFHPACIDMTVEEAKRLDHFFCENCSAEGQKKLQNSHSASRHS 205 Query: 412 DVKVDTK 392 D KVDTK Sbjct: 206 DTKVDTK 212 >gb|EYU37830.1| hypothetical protein MIMGU_mgv1a013467mg [Mimulus guttatus] Length = 219 Score = 109 bits (272), Expect = 7e-22 Identities = 46/67 (68%), Positives = 58/67 (86%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPD+LMVQCEGC++WFHPTCI+M+PEEA+ L+ FYCL+C+ E++ KL NS VST + Sbjct: 149 MPYNPDELMVQCEGCTEWFHPTCIEMTPEEAKKLDCFYCLSCSSEDQNKLQNSHVSTGHS 208 Query: 412 DVKVDTK 392 D KVDTK Sbjct: 209 DEKVDTK 215 >ref|XP_007042081.1| PHD finger family protein / bromo-adjacent domain-containing protein isoform 1 [Theobroma cacao] gi|508706016|gb|EOX97912.1| PHD finger family protein / bromo-adjacent domain-containing protein isoform 1 [Theobroma cacao] Length = 216 Score = 109 bits (272), Expect = 7e-22 Identities = 45/67 (67%), Positives = 56/67 (83%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGCSDWFHP CI+M+ EEA+ L+HF+C +C+ E +KKL NS ++R + Sbjct: 146 MPYNPDDLMVQCEGCSDWFHPACIEMTAEEAKRLDHFFCESCSSEGQKKLQNSHATSRHS 205 Query: 412 DVKVDTK 392 D KVDTK Sbjct: 206 DTKVDTK 212 >ref|XP_007135939.1| hypothetical protein PHAVU_009G004500g [Phaseolus vulgaris] gi|561009026|gb|ESW07933.1| hypothetical protein PHAVU_009G004500g [Phaseolus vulgaris] Length = 216 Score = 108 bits (271), Expect = 9e-22 Identities = 46/67 (68%), Positives = 56/67 (83%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGCSDWFHP CIDM+ EEA+ L+HF+C +C+ E +KKL NS ++R + Sbjct: 146 MPYNPDDLMVQCEGCSDWFHPACIDMTVEEAKRLDHFFCESCSAEGQKKLQNSHSASRLS 205 Query: 412 DVKVDTK 392 D KVDTK Sbjct: 206 DTKVDTK 212 >ref|XP_006362024.1| PREDICTED: protein winged eye-like [Solanum tuberosum] Length = 211 Score = 108 bits (270), Expect = 1e-21 Identities = 47/67 (70%), Positives = 57/67 (85%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGCSDWFHPTCIDM+PEEA+ L+HF+C NC+ E++KKL NS A Sbjct: 146 MPYNPDDLMVQCEGCSDWFHPTCIDMTPEEAKRLDHFFCQNCSSEDQKKLLNSH-----A 200 Query: 412 DVKVDTK 392 D+KV++K Sbjct: 201 DIKVESK 207 >ref|XP_007200462.1| hypothetical protein PRUPE_ppa011301mg [Prunus persica] gi|462395862|gb|EMJ01661.1| hypothetical protein PRUPE_ppa011301mg [Prunus persica] Length = 216 Score = 108 bits (270), Expect = 1e-21 Identities = 45/67 (67%), Positives = 54/67 (80%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGCSDWFHP CIDM+ EEA+ L+HF+C C+ E +KKL NS +++ Sbjct: 146 MPYNPDDLMVQCEGCSDWFHPACIDMNAEEAKRLDHFFCEGCSSEGQKKLQNSHTASKHP 205 Query: 412 DVKVDTK 392 D KVDTK Sbjct: 206 DTKVDTK 212 >ref|XP_003527148.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like isoform X1 [Glycine max] Length = 216 Score = 108 bits (270), Expect = 1e-21 Identities = 45/67 (67%), Positives = 56/67 (83%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGC+DWFHP CIDM+ EEA+ L+HF+C +C+ E +KKL NS ++R + Sbjct: 146 MPYNPDDLMVQCEGCTDWFHPACIDMTVEEAKRLDHFFCESCSAEGQKKLQNSHSASRHS 205 Query: 412 DVKVDTK 392 D KVDTK Sbjct: 206 DTKVDTK 212 >ref|XP_002512960.1| phd finger transcription factor, putative [Ricinus communis] gi|223547971|gb|EEF49463.1| phd finger transcription factor, putative [Ricinus communis] Length = 216 Score = 108 bits (269), Expect = 1e-21 Identities = 44/67 (65%), Positives = 56/67 (83%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGC+DWFHPTCI+M+ EEA+ L+HF+C NC+ E +KKL NS ++R Sbjct: 146 MPYNPDDLMVQCEGCTDWFHPTCIEMTAEEAKRLDHFFCENCSSEGQKKLQNSHTTSRQP 205 Query: 412 DVKVDTK 392 + KV+TK Sbjct: 206 ETKVETK 212 >ref|XP_006423394.1| hypothetical protein CICLE_v10029260mg [Citrus clementina] gi|568868071|ref|XP_006487342.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like [Citrus sinensis] gi|557525328|gb|ESR36634.1| hypothetical protein CICLE_v10029260mg [Citrus clementina] Length = 216 Score = 106 bits (265), Expect = 4e-21 Identities = 44/67 (65%), Positives = 56/67 (83%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGCSDWFHP CI+M+ EEA+ L+HF+C +C+ E +KKL NS+ + R + Sbjct: 146 MPYNPDDLMVQCEGCSDWFHPNCINMTAEEAKRLDHFFCESCSTEGQKKLQNSQANGRHS 205 Query: 412 DVKVDTK 392 D KV+TK Sbjct: 206 DAKVETK 212 >ref|XP_004500782.1| PREDICTED: protein polybromo-1-like [Cicer arietinum] Length = 218 Score = 106 bits (265), Expect = 4e-21 Identities = 45/67 (67%), Positives = 54/67 (80%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPD+LMVQCEGCSDWFHP CIDM+ EEA+ L+HF+C +C+ E +KKL NS + R Sbjct: 148 MPYNPDELMVQCEGCSDWFHPACIDMTVEEAKRLDHFFCESCSVEGQKKLQNSHSAARHL 207 Query: 412 DVKVDTK 392 D KVDTK Sbjct: 208 DTKVDTK 214 >ref|XP_004148528.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] gi|449516389|ref|XP_004165229.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] Length = 216 Score = 106 bits (264), Expect = 6e-21 Identities = 44/67 (65%), Positives = 56/67 (83%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCE CSDWFHP CI+M+ EEA+ L+HFYC +C+ E +KKL NS+ +++ A Sbjct: 146 MPYNPDDLMVQCENCSDWFHPACIEMTTEEAKKLDHFYCESCSSEGQKKLQNSQSTSKVA 205 Query: 412 DVKVDTK 392 + KVDTK Sbjct: 206 ETKVDTK 212 >ref|XP_002305450.1| SHORT LIFE family protein [Populus trichocarpa] gi|222848414|gb|EEE85961.1| SHORT LIFE family protein [Populus trichocarpa] Length = 215 Score = 106 bits (264), Expect = 6e-21 Identities = 46/67 (68%), Positives = 55/67 (82%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGCSDWFHP CI+MS EEA+ L+HF+C NC+ E +KKL NS +TR + Sbjct: 146 MPYNPDDLMVQCEGCSDWFHPACIEMSAEEAKRLDHFFCENCSSEGQKKLQNSH-NTRQS 204 Query: 412 DVKVDTK 392 D K +TK Sbjct: 205 DAKAETK 211 >gb|EYU42596.1| hypothetical protein MIMGU_mgv1a013749mg [Mimulus guttatus] Length = 211 Score = 105 bits (263), Expect = 7e-21 Identities = 47/67 (70%), Positives = 54/67 (80%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCE CSDWFHPTCIDM+PEEA +EHFYC NC+ E++KKL S A Sbjct: 146 MPYNPDDLMVQCEECSDWFHPTCIDMTPEEARKVEHFYCYNCSTEDQKKLPTSH-----A 200 Query: 412 DVKVDTK 392 D+KV+TK Sbjct: 201 DMKVETK 207 >ref|XP_007042082.1| PHD finger family protein / bromo-adjacent domain-containing protein isoform 2 [Theobroma cacao] gi|508706017|gb|EOX97913.1| PHD finger family protein / bromo-adjacent domain-containing protein isoform 2 [Theobroma cacao] Length = 249 Score = 103 bits (256), Expect = 5e-20 Identities = 42/64 (65%), Positives = 53/64 (82%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGCSDWFHP CI+M+ EEA+ L+HF+C +C+ E +KKL NS ++R + Sbjct: 146 MPYNPDDLMVQCEGCSDWFHPACIEMTAEEAKRLDHFFCESCSSEGQKKLQNSHATSRHS 205 Query: 412 DVKV 401 D KV Sbjct: 206 DTKV 209 >ref|XP_007200463.1| hypothetical protein PRUPE_ppa011301mg [Prunus persica] gi|462395863|gb|EMJ01662.1| hypothetical protein PRUPE_ppa011301mg [Prunus persica] Length = 216 Score = 102 bits (254), Expect = 8e-20 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = -2 Query: 592 MPYNPDDLMVQCEGCSDWFHPTCIDMSPEEAEGLEHFYCLNCAPENKKKLHNSRVSTRGA 413 MPYNPDDLMVQCEGCSDWFHP CIDM+ EEA+ L+HF+C C+ E +KKL NS +++ Sbjct: 146 MPYNPDDLMVQCEGCSDWFHPACIDMNAEEAKRLDHFFCEGCSSEGQKKLQNSHTASKHP 205 Query: 412 DVKV 401 D KV Sbjct: 206 DTKV 209