BLASTX nr result
ID: Mentha22_contig00023922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00023922 (835 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19580.1| hypothetical protein MIMGU_mgv1a010353mg [Mimulus... 64 9e-08 >gb|EYU19580.1| hypothetical protein MIMGU_mgv1a010353mg [Mimulus guttatus] Length = 314 Score = 63.5 bits (153), Expect = 9e-08 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 6/69 (8%) Frame = -1 Query: 238 MAAGISVATTPGAVLRA---PFLGPKPAAR---ALRIPPSLHRVEAILRLGRRSPNLTVC 77 MAAGIS+ATT ++ + PFLGPKP + ++P SL + A+LR RR NLTVC Sbjct: 1 MAAGISMATTSRTIVHSRHSPFLGPKPTSLFTPTSKLPHSLQKFHAVLRFKRRKSNLTVC 60 Query: 76 FVLGDEKLS 50 FVL +EKL+ Sbjct: 61 FVLEEEKLA 69