BLASTX nr result
ID: Mentha22_contig00023870
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00023870 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38806.1| hypothetical protein MIMGU_mgv1a010193mg [Mimulus... 46 4e-06 >gb|EYU38806.1| hypothetical protein MIMGU_mgv1a010193mg [Mimulus guttatus] Length = 319 Score = 46.2 bits (108), Expect(2) = 4e-06 Identities = 34/82 (41%), Positives = 44/82 (53%), Gaps = 13/82 (15%) Frame = -2 Query: 313 SLLTSATREEIHVAQILLHISSVIRTLEYGSGLKWGRKKRR----------SRSDEAASP 164 SLL S T EE+ VAQILL + + LE +G KWG KKRR SR+ SP Sbjct: 16 SLLASVTEEELFVAQILLDLPYMFGMLESVTGPKWGGKKRRRSRMRNAPSSSRAPSPPSP 75 Query: 163 -YRKTDVEE--ERPPPPKAEME 107 R+T++ + E+ PK E E Sbjct: 76 SIRRTELVQVREKNHRPKTEEE 97 Score = 30.0 bits (66), Expect(2) = 4e-06 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 99 AATASPVTPLAFPPSESDD 43 AAT SPVTPL+F ESD+ Sbjct: 102 AATTSPVTPLSFSSGESDE 120