BLASTX nr result
ID: Mentha22_contig00023687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00023687 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007154005.1| hypothetical protein PHAVU_003G083000g [Phas... 57 3e-06 gb|AFK35097.1| unknown [Medicago truncatula] 57 3e-06 ref|XP_003610500.1| Acyl-protein thioesterase [Medicago truncatu... 57 3e-06 >ref|XP_007154005.1| hypothetical protein PHAVU_003G083000g [Phaseolus vulgaris] gi|561027359|gb|ESW25999.1| hypothetical protein PHAVU_003G083000g [Phaseolus vulgaris] Length = 272 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 347 FKAYPGLIHTINNEELRNLESWIKSRLQSPS 255 FKAYPGL H+INNEELR LESWIK+RLQS S Sbjct: 241 FKAYPGLAHSINNEELRYLESWIKARLQSSS 271 >gb|AFK35097.1| unknown [Medicago truncatula] Length = 161 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 347 FKAYPGLIHTINNEELRNLESWIKSRLQSPS 255 FKAYPGL H+INNEEL++LESWIK+RLQS S Sbjct: 131 FKAYPGLAHSINNEELKHLESWIKARLQSSS 161 >ref|XP_003610500.1| Acyl-protein thioesterase [Medicago truncatula] gi|355511555|gb|AES92697.1| Acyl-protein thioesterase [Medicago truncatula] gi|388512561|gb|AFK44342.1| unknown [Medicago truncatula] Length = 215 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 347 FKAYPGLIHTINNEELRNLESWIKSRLQSPS 255 FKAYPGL H+INNEEL++LESWIK+RLQS S Sbjct: 185 FKAYPGLAHSINNEELKHLESWIKARLQSSS 215