BLASTX nr result
ID: Mentha22_contig00023638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00023638 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37516.1| hypothetical protein MIMGU_mgv1a006119mg [Mimulus... 69 1e-09 gb|EYU37515.1| hypothetical protein MIMGU_mgv1a006119mg [Mimulus... 69 1e-09 ref|XP_006361245.1| PREDICTED: cyclin-dependent kinase F-4-like ... 67 3e-09 ref|XP_006361244.1| PREDICTED: cyclin-dependent kinase F-4-like ... 67 3e-09 ref|XP_006361243.1| PREDICTED: cyclin-dependent kinase F-4-like ... 67 3e-09 ref|XP_006361242.1| PREDICTED: cyclin-dependent kinase F-4-like ... 67 3e-09 ref|XP_006432566.1| hypothetical protein CICLE_v10003654mg [Citr... 67 4e-09 gb|EPS63316.1| hypothetical protein M569_11466, partial [Genlise... 67 4e-09 ref|XP_006573477.1| PREDICTED: cyclin-dependent kinase F-4-like ... 67 5e-09 ref|XP_003612616.1| Serine/threonine protein kinase ICK [Medicag... 67 5e-09 gb|EPS73064.1| hypothetical protein M569_01692, partial [Genlise... 66 6e-09 ref|XP_006599209.1| PREDICTED: cyclin-dependent kinase F-4-like ... 66 8e-09 ref|XP_007156359.1| hypothetical protein PHAVU_003G279600g [Phas... 66 8e-09 ref|XP_004512408.1| PREDICTED: cyclin-dependent kinase F-4-like ... 66 8e-09 ref|XP_003547727.1| PREDICTED: cyclin-dependent kinase F-4-like ... 66 8e-09 ref|XP_002519870.1| mak, putative [Ricinus communis] gi|22354091... 66 8e-09 ref|XP_006655724.1| PREDICTED: cyclin-dependent kinase F-4-like ... 65 1e-08 ref|XP_004509543.1| PREDICTED: cyclin-dependent kinase F-4-like ... 65 1e-08 ref|NP_001056617.1| Os06g0116100 [Oryza sativa Japonica Group] g... 65 1e-08 gb|EEC79880.1| hypothetical protein OsI_21386 [Oryza sativa Indi... 65 1e-08 >gb|EYU37516.1| hypothetical protein MIMGU_mgv1a006119mg [Mimulus guttatus] Length = 456 Score = 68.6 bits (166), Expect = 1e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG+G FGSVWRALSKQSGEVVAIKKMK Sbjct: 1 MERYKVIKEVGNGTFGSVWRALSKQSGEVVAIKKMK 36 >gb|EYU37515.1| hypothetical protein MIMGU_mgv1a006119mg [Mimulus guttatus] Length = 455 Score = 68.6 bits (166), Expect = 1e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG+G FGSVWRALSKQSGEVVAIKKMK Sbjct: 1 MERYKVIKEVGNGTFGSVWRALSKQSGEVVAIKKMK 36 >ref|XP_006361245.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X4 [Solanum tuberosum] Length = 445 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG+G FGSVWRAL+KQSGEVVAIKKMK Sbjct: 1 MERYKVIKEVGNGTFGSVWRALNKQSGEVVAIKKMK 36 >ref|XP_006361244.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Solanum tuberosum] Length = 446 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG+G FGSVWRAL+KQSGEVVAIKKMK Sbjct: 1 MERYKVIKEVGNGTFGSVWRALNKQSGEVVAIKKMK 36 >ref|XP_006361243.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Solanum tuberosum] Length = 450 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG+G FGSVWRAL+KQSGEVVAIKKMK Sbjct: 1 MERYKVIKEVGNGTFGSVWRALNKQSGEVVAIKKMK 36 >ref|XP_006361242.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Solanum tuberosum] Length = 451 Score = 67.4 bits (163), Expect = 3e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG+G FGSVWRAL+KQSGEVVAIKKMK Sbjct: 1 MERYKVIKEVGNGTFGSVWRALNKQSGEVVAIKKMK 36 >ref|XP_006432566.1| hypothetical protein CICLE_v10003654mg [Citrus clementina] gi|568834447|ref|XP_006471340.1| PREDICTED: cyclin-dependent kinase F-4-like [Citrus sinensis] gi|557534688|gb|ESR45806.1| hypothetical protein CICLE_v10003654mg [Citrus clementina] Length = 455 Score = 67.0 bits (162), Expect = 4e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG G FGSVWRA+SKQSGEVVAIKKMK Sbjct: 1 MERYKLIKEVGDGTFGSVWRAISKQSGEVVAIKKMK 36 >gb|EPS63316.1| hypothetical protein M569_11466, partial [Genlisea aurea] Length = 390 Score = 67.0 bits (162), Expect = 4e-09 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG+G FGSVWRA+SKQSGEVVA+KKMK Sbjct: 1 MERYKLIKEVGNGTFGSVWRAISKQSGEVVAVKKMK 36 >ref|XP_006573477.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Glycine max] gi|571435421|ref|XP_006573478.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Glycine max] Length = 476 Score = 66.6 bits (161), Expect = 5e-09 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +2 Query: 476 TMERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 TMER+K+IKEVG G FGSVWRA++KQ+GEVVAIKKMK Sbjct: 26 TMERYKLIKEVGDGTFGSVWRAINKQTGEVVAIKKMK 62 >ref|XP_003612616.1| Serine/threonine protein kinase ICK [Medicago truncatula] gi|355513951|gb|AES95574.1| Serine/threonine protein kinase ICK [Medicago truncatula] Length = 449 Score = 66.6 bits (161), Expect = 5e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+KIIKEVG G FGSVWRA+SKQ+GEVVAIKKMK Sbjct: 1 MERYKIIKEVGDGTFGSVWRAISKQTGEVVAIKKMK 36 >gb|EPS73064.1| hypothetical protein M569_01692, partial [Genlisea aurea] Length = 384 Score = 66.2 bits (160), Expect = 6e-09 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG+G FGSVWRA+S+QSGEVVAIKKMK Sbjct: 25 MERYKVIKEVGNGTFGSVWRAISQQSGEVVAIKKMK 60 >ref|XP_006599209.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max] Length = 451 Score = 65.9 bits (159), Expect = 8e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG G FGSVWRA++KQSGEVVAIKKMK Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAIKKMK 36 >ref|XP_007156359.1| hypothetical protein PHAVU_003G279600g [Phaseolus vulgaris] gi|561029713|gb|ESW28353.1| hypothetical protein PHAVU_003G279600g [Phaseolus vulgaris] Length = 448 Score = 65.9 bits (159), Expect = 8e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG G FGSVWRA++KQSGEVVAIKKMK Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAIKKMK 36 >ref|XP_004512408.1| PREDICTED: cyclin-dependent kinase F-4-like [Cicer arietinum] Length = 449 Score = 65.9 bits (159), Expect = 8e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG G FGSVWRA+SKQ+GEVVAIKKMK Sbjct: 1 MERYKLIKEVGDGTFGSVWRAISKQTGEVVAIKKMK 36 >ref|XP_003547727.1| PREDICTED: cyclin-dependent kinase F-4-like [Glycine max] Length = 450 Score = 65.9 bits (159), Expect = 8e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG G FGSVWRA++KQSGEVVAIKKMK Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAIKKMK 36 >ref|XP_002519870.1| mak, putative [Ricinus communis] gi|223540916|gb|EEF42474.1| mak, putative [Ricinus communis] Length = 455 Score = 65.9 bits (159), Expect = 8e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG G FGSVWRA++KQSGEVVAIKKMK Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEVVAIKKMK 36 >ref|XP_006655724.1| PREDICTED: cyclin-dependent kinase F-4-like [Oryza brachyantha] Length = 480 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+KIIKEVG G FGSVWRA++K+SGEVVAIKKMK Sbjct: 1 MERYKIIKEVGDGTFGSVWRAINKESGEVVAIKKMK 36 >ref|XP_004509543.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X1 [Cicer arietinum] gi|502154004|ref|XP_004509544.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X2 [Cicer arietinum] gi|502154006|ref|XP_004509545.1| PREDICTED: cyclin-dependent kinase F-4-like isoform X3 [Cicer arietinum] Length = 451 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+K+IKEVG G FGSVWRA++KQSGE+VAIKKMK Sbjct: 1 MERYKLIKEVGDGTFGSVWRAINKQSGEIVAIKKMK 36 >ref|NP_001056617.1| Os06g0116100 [Oryza sativa Japonica Group] gi|55296195|dbj|BAD67913.1| putative GAMYB-binding protein [Oryza sativa Japonica Group] gi|113594657|dbj|BAF18531.1| Os06g0116100 [Oryza sativa Japonica Group] gi|194396107|gb|ACF60471.1| myb-binding protein [Oryza sativa Japonica Group] gi|215697479|dbj|BAG91473.1| unnamed protein product [Oryza sativa Japonica Group] gi|222634854|gb|EEE64986.1| hypothetical protein OsJ_19906 [Oryza sativa Japonica Group] Length = 484 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+KIIKEVG G FGSVWRA++K+SGEVVAIKKMK Sbjct: 1 MERYKIIKEVGDGTFGSVWRAINKESGEVVAIKKMK 36 >gb|EEC79880.1| hypothetical protein OsI_21386 [Oryza sativa Indica Group] Length = 419 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 479 MERFKIIKEVGSGAFGSVWRALSKQSGEVVAIKKMK 586 MER+KIIKEVG G FGSVWRA++K+SGEVVAIKKMK Sbjct: 1 MERYKIIKEVGDGTFGSVWRAINKESGEVVAIKKMK 36