BLASTX nr result
ID: Mentha22_contig00023203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00023203 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528006.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002528006.1| conserved hypothetical protein [Ricinus communis] gi|223532632|gb|EEF34418.1| conserved hypothetical protein [Ricinus communis] Length = 1871 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = -1 Query: 449 GDFIMDGVDFDG--SGILEIVTEGXXXXXXXDILESFSSGDEDD 324 GDF+MDG+DFDG +GILEIVTEG ++ES+SSG+EDD Sbjct: 1820 GDFMMDGMDFDGGGAGILEIVTEGDEEDDDSQLVESYSSGEEDD 1863