BLASTX nr result
ID: Mentha22_contig00023075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00023075 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305350.1| hypothetical protein POPTR_0004s14230g [Popu... 57 3e-06 gb|EYU31209.1| hypothetical protein MIMGU_mgv1a026000mg, partial... 57 3e-06 >ref|XP_002305350.1| hypothetical protein POPTR_0004s14230g [Populus trichocarpa] gi|222848314|gb|EEE85861.1| hypothetical protein POPTR_0004s14230g [Populus trichocarpa] Length = 688 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/28 (82%), Positives = 24/28 (85%) Frame = -3 Query: 331 WQHTRCSGIPDSDCVPVKFYCHRCRGSN 248 WQHTRCSGIPDSD VP KF C RCRGS+ Sbjct: 660 WQHTRCSGIPDSDSVPAKFVCLRCRGSS 687 >gb|EYU31209.1| hypothetical protein MIMGU_mgv1a026000mg, partial [Mimulus guttatus] Length = 685 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = -3 Query: 331 WQHTRCSGIPDSDCVPVKFYCHRCRGSNKANGXXXXQCREQ 209 WQHTRC GIPDS+ VP +F+C RCR + K NG QCR++ Sbjct: 649 WQHTRCCGIPDSEGVPARFFCQRCRPTTKMNG----QCRDE 685