BLASTX nr result
ID: Mentha22_contig00023042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00023042 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18487.1| hypothetical protein MIMGU_mgv1a025371mg, partial... 63 4e-08 >gb|EYU18487.1| hypothetical protein MIMGU_mgv1a025371mg, partial [Mimulus guttatus] Length = 623 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/68 (47%), Positives = 44/68 (64%) Frame = +1 Query: 1 KFSCPDPIKVKTISENHDFLNGYSPNNFAMSDVPSRYEECSWTSEKSDSYTSNLTGPDIE 180 KF + VK IS+NH+ + S N+ M+ VP+R+ SWTSEKSDS S + GP + Sbjct: 248 KFPYGESNPVKNISQNHNSSSCSSANDSTMTYVPTRFNHSSWTSEKSDSCMSFVNGPAMA 307 Query: 181 DSKDGFIP 204 +S+DGFIP Sbjct: 308 NSEDGFIP 315