BLASTX nr result
ID: Mentha22_contig00022557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00022557 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39977.1| hypothetical protein MIMGU_mgv1a007447mg [Mimulus... 64 2e-08 ref|XP_007202172.1| hypothetical protein PRUPE_ppa006528mg [Prun... 63 5e-08 ref|XP_006402782.1| hypothetical protein EUTSA_v10006516mg [Eutr... 62 8e-08 emb|CBI29969.3| unnamed protein product [Vitis vinifera] 62 8e-08 ref|XP_002531164.1| sphingosine-1-phosphate phosphohydrolase, pu... 62 8e-08 ref|XP_002281162.1| PREDICTED: dihydrosphingosine 1-phosphate ph... 62 8e-08 ref|XP_006842772.1| hypothetical protein AMTR_s00133p00106740 [A... 62 1e-07 gb|EPS61952.1| phosphatidic acid phosphatase family protein, par... 61 1e-07 ref|XP_006360606.1| PREDICTED: dihydrosphingosine 1-phosphate ph... 60 3e-07 ref|XP_007163033.1| hypothetical protein PHAVU_001G200400g [Phas... 60 3e-07 ref|XP_004494305.1| PREDICTED: dihydrosphingosine 1-phosphate ph... 60 3e-07 ref|XP_006291211.1| hypothetical protein CARUB_v10017341mg [Caps... 60 3e-07 ref|XP_004234755.1| PREDICTED: dihydrosphingosine 1-phosphate ph... 60 3e-07 ref|NP_001078308.1| sphingoid phosphate phosphatase 1 [Arabidops... 60 3e-07 dbj|BAE99276.1| hypothetical protein [Arabidopsis thaliana] 60 3e-07 ref|NP_191408.1| sphingoid phosphate phosphatase 1 [Arabidopsis ... 60 3e-07 ref|XP_002308348.1| phosphatidic acid phosphatase family protein... 60 4e-07 ref|XP_007029091.1| Phosphatidic acid phosphatase (PAP2) family ... 59 5e-07 ref|XP_006604689.1| PREDICTED: dihydrosphingosine 1-phosphate ph... 59 7e-07 ref|XP_006577115.1| PREDICTED: dihydrosphingosine 1-phosphate ph... 59 7e-07 >gb|EYU39977.1| hypothetical protein MIMGU_mgv1a007447mg [Mimulus guttatus] Length = 407 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFDVD+GIRL+QYAGLAWSVVDLVPSMFSH+ L Sbjct: 375 SFDVDSGIRLIQYAGLAWSVVDLVPSMFSHLAL 407 >ref|XP_007202172.1| hypothetical protein PRUPE_ppa006528mg [Prunus persica] gi|462397703|gb|EMJ03371.1| hypothetical protein PRUPE_ppa006528mg [Prunus persica] Length = 407 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFDVDTGIR LQYAGLAWSVVDLVPS+F+H+ L Sbjct: 375 SFDVDTGIRFLQYAGLAWSVVDLVPSLFTHLSL 407 >ref|XP_006402782.1| hypothetical protein EUTSA_v10006516mg [Eutrema salsugineum] gi|557103881|gb|ESQ44235.1| hypothetical protein EUTSA_v10006516mg [Eutrema salsugineum] Length = 411 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFD+DTGIR LQYAGLAWSVVDLVPS+FS+I L Sbjct: 379 SFDIDTGIRFLQYAGLAWSVVDLVPSLFSYINL 411 >emb|CBI29969.3| unnamed protein product [Vitis vinifera] Length = 442 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFDVDTGIR LQYAGLAWSVVDLVPSMFS + L Sbjct: 410 SFDVDTGIRFLQYAGLAWSVVDLVPSMFSQLNL 442 >ref|XP_002531164.1| sphingosine-1-phosphate phosphohydrolase, putative [Ricinus communis] gi|223529234|gb|EEF31207.1| sphingosine-1-phosphate phosphohydrolase, putative [Ricinus communis] Length = 406 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SF+VDTGIR LQYAGLAWSVVDLVPS+FSH+ L Sbjct: 374 SFNVDTGIRFLQYAGLAWSVVDLVPSLFSHLSL 406 >ref|XP_002281162.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11 isoform 1 [Vitis vinifera] Length = 407 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFDVDTGIR LQYAGLAWSVVDLVPSMFS + L Sbjct: 375 SFDVDTGIRFLQYAGLAWSVVDLVPSMFSQLNL 407 >ref|XP_006842772.1| hypothetical protein AMTR_s00133p00106740 [Amborella trichopoda] gi|548844886|gb|ERN04447.1| hypothetical protein AMTR_s00133p00106740 [Amborella trichopoda] Length = 406 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 S+DVDTGIR LQYAGLAWSVVDLVPS+FSH+ L Sbjct: 374 SYDVDTGIRFLQYAGLAWSVVDLVPSIFSHLRL 406 >gb|EPS61952.1| phosphatidic acid phosphatase family protein, partial [Genlisea aurea] Length = 395 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFD+DTGIRLLQYAGLAWSVVDLVPS+F+ +GL Sbjct: 363 SFDLDTGIRLLQYAGLAWSVVDLVPSLFAILGL 395 >ref|XP_006360606.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11-like [Solanum tuberosum] Length = 407 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SF+VDTGIRL QYA LAWSVVDLVPS+F H+GL Sbjct: 375 SFEVDTGIRLFQYASLAWSVVDLVPSLFFHLGL 407 >ref|XP_007163033.1| hypothetical protein PHAVU_001G200400g [Phaseolus vulgaris] gi|561036497|gb|ESW35027.1| hypothetical protein PHAVU_001G200400g [Phaseolus vulgaris] Length = 406 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 +FDVDTGIR LQYAGLAWSVVDLVPS+FS++ L Sbjct: 374 AFDVDTGIRFLQYAGLAWSVVDLVPSLFSYMSL 406 >ref|XP_004494305.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11-like [Cicer arietinum] Length = 389 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 +FDVDTGIR LQYAGLAWSVVDLVPS+FS++ L Sbjct: 357 AFDVDTGIRFLQYAGLAWSVVDLVPSLFSYMNL 389 >ref|XP_006291211.1| hypothetical protein CARUB_v10017341mg [Capsella rubella] gi|482559918|gb|EOA24109.1| hypothetical protein CARUB_v10017341mg [Capsella rubella] Length = 415 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFD+DTGIR QYAGLAWSVVDLVPS+FS+I L Sbjct: 383 SFDIDTGIRFFQYAGLAWSVVDLVPSIFSYINL 415 >ref|XP_004234755.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase LCB3-like [Solanum lycopersicum] Length = 404 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SF+VDTGIRL QYAGLAWSVVDLVPS+F H+ L Sbjct: 372 SFEVDTGIRLFQYAGLAWSVVDLVPSLFFHLSL 404 >ref|NP_001078308.1| sphingoid phosphate phosphatase 1 [Arabidopsis thaliana] gi|332646268|gb|AEE79789.1| sphingoid phosphate phosphatase 1 [Arabidopsis thaliana] Length = 346 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFD+DTGIR QYAGLAWSVVDLVPS+FS++ L Sbjct: 314 SFDIDTGIRFFQYAGLAWSVVDLVPSLFSYVNL 346 >dbj|BAE99276.1| hypothetical protein [Arabidopsis thaliana] Length = 346 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFD+DTGIR QYAGLAWSVVDLVPS+FS++ L Sbjct: 314 SFDIDTGIRFFQYAGLAWSVVDLVPSLFSYVNL 346 >ref|NP_191408.1| sphingoid phosphate phosphatase 1 [Arabidopsis thaliana] gi|75264595|sp|Q9M2G7.1|LPPD_ARATH RecName: Full=Lipid phosphate phosphatase delta; Short=AtLPPD; AltName: Full=Phosphatidic acid phosphatase delta; AltName: Full=Sphingoid phosphate phosphatase 1; Short=AtSSP1; AltName: Full=Sphingosine-1-phosphate phosphatase; Short=AtSPPASE gi|6735366|emb|CAB68187.1| putative protein [Arabidopsis thaliana] gi|78126073|dbj|BAE46997.1| sphingosine-1-phosphate phosphatase [Arabidopsis thaliana] gi|332646267|gb|AEE79788.1| sphingoid phosphate phosphatase 1 [Arabidopsis thaliana] Length = 416 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFD+DTGIR QYAGLAWSVVDLVPS+FS++ L Sbjct: 384 SFDIDTGIRFFQYAGLAWSVVDLVPSLFSYVNL 416 >ref|XP_002308348.1| phosphatidic acid phosphatase family protein [Populus trichocarpa] gi|222854324|gb|EEE91871.1| phosphatidic acid phosphatase family protein [Populus trichocarpa] Length = 407 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 SFDVDTGIR LQY+GLAWSVVDLVPS+FS++ L Sbjct: 375 SFDVDTGIRFLQYSGLAWSVVDLVPSLFSYLRL 407 >ref|XP_007029091.1| Phosphatidic acid phosphatase (PAP2) family protein [Theobroma cacao] gi|508717696|gb|EOY09593.1| Phosphatidic acid phosphatase (PAP2) family protein [Theobroma cacao] Length = 407 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 339 FDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 FDVDTGIR LQYAGLAWSVVDLVPS+FS++ L Sbjct: 376 FDVDTGIRFLQYAGLAWSVVDLVPSLFSYLRL 407 >ref|XP_006604689.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11-like [Glycine max] Length = 406 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 +FDVDTGIR +QYAGLAWSVVDLVPS+FS++ L Sbjct: 374 AFDVDTGIRFVQYAGLAWSVVDLVPSLFSYMSL 406 >ref|XP_006577115.1| PREDICTED: dihydrosphingosine 1-phosphate phosphatase C823.11-like [Glycine max] Length = 406 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 342 SFDVDTGIRLLQYAGLAWSVVDLVPSMFSHIGL 244 +FDVDTGIR +QYAGLAWSVVDLVPS+FS++ L Sbjct: 374 AFDVDTGIRFVQYAGLAWSVVDLVPSLFSYMSL 406