BLASTX nr result
ID: Mentha22_contig00022534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00022534 (738 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45026.1| hypothetical protein MIMGU_mgv1a007930mg [Mimulus... 60 6e-07 >gb|EYU45026.1| hypothetical protein MIMGU_mgv1a007930mg [Mimulus guttatus] Length = 390 Score = 60.5 bits (145), Expect = 6e-07 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = +1 Query: 250 IKVQLSDGKKYLAEASRQSDDKDDKLEQGNLKKQKLSTSEEGTKLQLEIAITASDIKEKY 429 IK L +G + + S ++ D EQGNLKKQKL+ SEEG +LQLE+ I+ASD+KEKY Sbjct: 139 IKKLLDEGAQASEKVSEIEENDDKDPEQGNLKKQKLA-SEEGAELQLEMVISASDVKEKY 197 Query: 430 K 432 K Sbjct: 198 K 198