BLASTX nr result
ID: Mentha22_contig00022429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00022429 (910 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26387.1| hypothetical protein MIMGU_mgv1a002272mg [Mimulus... 62 4e-07 >gb|EYU26387.1| hypothetical protein MIMGU_mgv1a002272mg [Mimulus guttatus] Length = 692 Score = 61.6 bits (148), Expect = 4e-07 Identities = 34/59 (57%), Positives = 42/59 (71%) Frame = +3 Query: 144 MESPTAFPRFSHQNPKKRTFSGDGSGSSLTACKEVEVLEAPPPEMDRSSKPKLSKEKGV 320 MESPT R+ QN KKR+F +GSS + CK+ EVLE PPP ++RSSKPK SK+K V Sbjct: 1 MESPTPVSRYIPQNSKKRSFM---AGSSSSGCKDAEVLEIPPP-INRSSKPKSSKQKEV 55