BLASTX nr result
ID: Mentha22_contig00022258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00022258 (453 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGQ04214.1| WRKY transcription factor 26 [Jatropha curcas] 109 4e-22 ref|XP_007025165.1| WRKY DNA-binding protein 28 [Theobroma cacao... 109 4e-22 ref|XP_004293668.1| PREDICTED: probable WRKY transcription facto... 109 4e-22 ref|XP_007214251.1| hypothetical protein PRUPE_ppa024027mg [Prun... 109 4e-22 ref|XP_002519733.1| WRKY transcription factor, putative [Ricinus... 109 4e-22 ref|XP_003524110.1| PREDICTED: probable WRKY transcription facto... 108 8e-22 ref|XP_007158965.1| hypothetical protein PHAVU_002G196800g [Phas... 108 1e-21 ref|XP_006369893.1| hypothetical protein POPTR_0001s34520g [Popu... 108 1e-21 ref|XP_004969457.1| PREDICTED: probable WRKY transcription facto... 108 1e-21 ref|XP_007217821.1| hypothetical protein PRUPE_ppa026831mg [Prun... 108 1e-21 ref|XP_003532648.1| PREDICTED: probable WRKY transcription facto... 108 1e-21 gb|AEO31489.1| WRKY transcription factor 29-1 [Dimocarpus longan] 108 1e-21 gb|ACV92031.1| WRKY transcription factor 29 [(Populus tomentosa ... 108 1e-21 ref|XP_002458273.1| hypothetical protein SORBIDRAFT_03g030480 [S... 108 1e-21 gb|EXB92394.1| putative WRKY transcription factor 28 [Morus nota... 107 1e-21 ref|XP_004303874.1| PREDICTED: probable WRKY transcription facto... 107 1e-21 ref|XP_002272089.1| PREDICTED: probable WRKY transcription facto... 107 1e-21 emb|CAN72742.1| hypothetical protein VITISV_042733 [Vitis vinifera] 107 1e-21 ref|XP_007048873.1| WRKY DNA-binding protein 28, putative [Theob... 107 2e-21 ref|NP_001169830.1| putative WRKY DNA-binding domain superfamily... 107 2e-21 >gb|AGQ04214.1| WRKY transcription factor 26 [Jatropha curcas] Length = 315 Score = 109 bits (272), Expect = 4e-22 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 155 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 202 >ref|XP_007025165.1| WRKY DNA-binding protein 28 [Theobroma cacao] gi|508780531|gb|EOY27787.1| WRKY DNA-binding protein 28 [Theobroma cacao] Length = 371 Score = 109 bits (272), Expect = 4e-22 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 146 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 193 >ref|XP_004293668.1| PREDICTED: probable WRKY transcription factor 28-like [Fragaria vesca subsp. vesca] Length = 355 Score = 109 bits (272), Expect = 4e-22 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 179 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 226 >ref|XP_007214251.1| hypothetical protein PRUPE_ppa024027mg [Prunus persica] gi|462410116|gb|EMJ15450.1| hypothetical protein PRUPE_ppa024027mg [Prunus persica] Length = 337 Score = 109 bits (272), Expect = 4e-22 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 165 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 212 >ref|XP_002519733.1| WRKY transcription factor, putative [Ricinus communis] gi|223541150|gb|EEF42706.1| WRKY transcription factor, putative [Ricinus communis] Length = 310 Score = 109 bits (272), Expect = 4e-22 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 149 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 196 >ref|XP_003524110.1| PREDICTED: probable WRKY transcription factor 28-like [Glycine max] Length = 358 Score = 108 bits (270), Expect = 8e-22 Identities = 53/78 (67%), Positives = 57/78 (73%), Gaps = 1/78 (1%) Frame = +3 Query: 222 KGKKEAK-ETLEDDXXXXXXXXXXXXXXXXQREPRFAFMTKSEVDHLEDGYRWRKYGQKA 398 K KKE + +T E + Q+EPRFAFMTKSEVDHLEDGYRWRKYGQKA Sbjct: 139 KSKKERQVKTEEGEENSKKGNKEKKKGEKKQKEPRFAFMTKSEVDHLEDGYRWRKYGQKA 198 Query: 399 VKNSPYPRSYYRCTTQKC 452 VKNSPYPRSYYRCTTQKC Sbjct: 199 VKNSPYPRSYYRCTTQKC 216 >ref|XP_007158965.1| hypothetical protein PHAVU_002G196800g [Phaseolus vulgaris] gi|561032380|gb|ESW30959.1| hypothetical protein PHAVU_002G196800g [Phaseolus vulgaris] Length = 358 Score = 108 bits (269), Expect = 1e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 Q+EPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 168 QKEPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 215 >ref|XP_006369893.1| hypothetical protein POPTR_0001s34520g [Populus trichocarpa] gi|550348862|gb|ERP66462.1| hypothetical protein POPTR_0001s34520g [Populus trichocarpa] Length = 312 Score = 108 bits (269), Expect = 1e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 Q+EPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 153 QKEPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 200 >ref|XP_004969457.1| PREDICTED: probable WRKY transcription factor 48-like isoform X1 [Setaria italica] Length = 385 Score = 108 bits (269), Expect = 1e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QR+PRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 176 QRQPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 223 >ref|XP_007217821.1| hypothetical protein PRUPE_ppa026831mg [Prunus persica] gi|462413971|gb|EMJ19020.1| hypothetical protein PRUPE_ppa026831mg [Prunus persica] Length = 360 Score = 108 bits (269), Expect = 1e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QREPRFAF+TKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 174 QREPRFAFLTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 221 >ref|XP_003532648.1| PREDICTED: probable WRKY transcription factor 28-like [Glycine max] Length = 371 Score = 108 bits (269), Expect = 1e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 Q+EPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 173 QKEPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 220 >gb|AEO31489.1| WRKY transcription factor 29-1 [Dimocarpus longan] Length = 84 Score = 108 bits (269), Expect = 1e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 Q+EPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 3 QKEPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 50 >gb|ACV92031.1| WRKY transcription factor 29 [(Populus tomentosa x Populus bolleana) x Populus tomentosa] Length = 313 Score = 108 bits (269), Expect = 1e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 Q+EPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 153 QKEPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 200 >ref|XP_002458273.1| hypothetical protein SORBIDRAFT_03g030480 [Sorghum bicolor] gi|241930248|gb|EES03393.1| hypothetical protein SORBIDRAFT_03g030480 [Sorghum bicolor] Length = 410 Score = 108 bits (269), Expect = 1e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QR+PRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 192 QRQPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 239 >gb|EXB92394.1| putative WRKY transcription factor 28 [Morus notabilis] Length = 380 Score = 107 bits (268), Expect = 1e-21 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QREPRFAF+TKSE+DHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 209 QREPRFAFLTKSEIDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 256 >ref|XP_004303874.1| PREDICTED: probable WRKY transcription factor 28-like [Fragaria vesca subsp. vesca] Length = 368 Score = 107 bits (268), Expect = 1e-21 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QREPRFAF+TKSE+DHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 185 QREPRFAFLTKSEIDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 232 >ref|XP_002272089.1| PREDICTED: probable WRKY transcription factor 28 [Vitis vinifera] gi|297740645|emb|CBI30827.3| unnamed protein product [Vitis vinifera] Length = 319 Score = 107 bits (268), Expect = 1e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSP+PRSYYRCTTQKC Sbjct: 164 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPFPRSYYRCTTQKC 211 >emb|CAN72742.1| hypothetical protein VITISV_042733 [Vitis vinifera] Length = 339 Score = 107 bits (268), Expect = 1e-21 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSP+PRSYYRCTTQKC Sbjct: 184 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPFPRSYYRCTTQKC 231 >ref|XP_007048873.1| WRKY DNA-binding protein 28, putative [Theobroma cacao] gi|508701134|gb|EOX93030.1| WRKY DNA-binding protein 28, putative [Theobroma cacao] Length = 316 Score = 107 bits (266), Expect = 2e-21 Identities = 49/77 (63%), Positives = 55/77 (71%) Frame = +3 Query: 222 KGKKEAKETLEDDXXXXXXXXXXXXXXXXQREPRFAFMTKSEVDHLEDGYRWRKYGQKAV 401 K KK+ + +D QREPRFAF+TKSE+DHLEDGYRWRKYGQKAV Sbjct: 131 KSKKDKQPKGAEDADDKSKKVNKPKKEKRQREPRFAFLTKSEIDHLEDGYRWRKYGQKAV 190 Query: 402 KNSPYPRSYYRCTTQKC 452 KNSPYPRSYYRCT+QKC Sbjct: 191 KNSPYPRSYYRCTSQKC 207 >ref|NP_001169830.1| putative WRKY DNA-binding domain superfamily protein [Zea mays] gi|224031875|gb|ACN35013.1| unknown [Zea mays] gi|414881090|tpg|DAA58221.1| TPA: putative WRKY DNA-binding domain superfamily protein [Zea mays] Length = 381 Score = 107 bits (266), Expect = 2e-21 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = +3 Query: 309 QREPRFAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 452 QR+PRFAF+TKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC Sbjct: 184 QRQPRFAFLTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKC 231