BLASTX nr result
ID: Mentha22_contig00020970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00020970 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22093.1| hypothetical protein MIMGU_mgv1a000993mg [Mimulus... 58 2e-06 >gb|EYU22093.1| hypothetical protein MIMGU_mgv1a000993mg [Mimulus guttatus] Length = 918 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -3 Query: 184 KSTEKIFTSSGIHEAFVGSREYEKLTLEGGQFGLGFKRSYSE 59 K +IF ++ IH+AF+G EYE L L GGQFGLGFKRSYSE Sbjct: 797 KDYTRIFGNARIHDAFMGVGEYEDLVLSGGQFGLGFKRSYSE 838