BLASTX nr result
ID: Mentha22_contig00020748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00020748 (803 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422261.1| hypothetical protein CICLE_v10004323mg [Citr... 58 4e-06 ref|XP_002887788.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] g... 58 4e-06 ref|XP_004138818.1| PREDICTED: pentatricopeptide repeat-containi... 58 5e-06 ref|XP_002316152.1| pentatricopeptide repeat-containing family p... 58 5e-06 ref|XP_006300415.1| hypothetical protein CARUB_v10021690mg [Caps... 57 8e-06 >ref|XP_006422261.1| hypothetical protein CICLE_v10004323mg [Citrus clementina] gi|568881878|ref|XP_006493776.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Citrus sinensis] gi|557524134|gb|ESR35501.1| hypothetical protein CICLE_v10004323mg [Citrus clementina] Length = 827 Score = 58.2 bits (139), Expect = 4e-06 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -1 Query: 125 FSERSLVREYCSGKNG-GEDSNNWTGEIDYLDEAGSVIYSGK 3 F + + VR YCSGK+G GE N WT EI+YLDE+GSVIY+GK Sbjct: 66 FRKPNYVRSYCSGKSGDGEKCNEWTEEIEYLDESGSVIYTGK 107 >ref|XP_002887788.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] gi|297333629|gb|EFH64047.1| EMB2217 [Arabidopsis lyrata subsp. lyrata] Length = 832 Score = 58.2 bits (139), Expect = 4e-06 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = -1 Query: 116 RSLVREYCSGKNGGEDSNNWTGEIDYLDEAGSVIYSGK 3 RS+VR +CS K+GG +S+ WT E++YLDE+GSV++SGK Sbjct: 74 RSIVRRFCSEKSGGSESSGWTEEVEYLDESGSVLHSGK 111 >ref|XP_004138818.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Cucumis sativus] gi|449490234|ref|XP_004158545.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Cucumis sativus] Length = 823 Score = 57.8 bits (138), Expect = 5e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = -1 Query: 125 FSERSLVREYCSGKNGGEDSNNWTGEIDYLDEAGSVIYSGK 3 F+ RS R YCSGK G WT +I+YLDE+GSVI+SGK Sbjct: 62 FNNRSFTRSYCSGKESGNGGREWTEDIEYLDESGSVIFSGK 102 >ref|XP_002316152.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|222865192|gb|EEF02323.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 785 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -1 Query: 113 SLVREYCSGKNGGEDSNNWTGEIDYLDEAGSVIYSGK 3 S VR YC+GKNG S WT +I+YLDE+GSVIYSGK Sbjct: 29 SFVRNYCAGKNGEAGSGEWTEDIEYLDESGSVIYSGK 65 >ref|XP_006300415.1| hypothetical protein CARUB_v10021690mg [Capsella rubella] gi|482569125|gb|EOA33313.1| hypothetical protein CARUB_v10021690mg [Capsella rubella] Length = 836 Score = 57.0 bits (136), Expect = 8e-06 Identities = 26/51 (50%), Positives = 37/51 (72%) Frame = -1 Query: 155 QDSRFCITTAFSERSLVREYCSGKNGGEDSNNWTGEIDYLDEAGSVIYSGK 3 +DS F + A RS+VR +CS K G +S+ WT E++YLDE+GSV++SGK Sbjct: 66 RDSDF-VGLAKQSRSIVRRFCSEKGGSSESSGWTEEVEYLDESGSVLHSGK 115