BLASTX nr result
ID: Mentha22_contig00020582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00020582 (524 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38917.1| hypothetical protein MIMGU_mgv1a0037492mg, partia... 110 3e-22 ref|XP_006402466.1| hypothetical protein EUTSA_v10005840mg [Eutr... 105 7e-21 ref|XP_006402465.1| hypothetical protein EUTSA_v10005840mg [Eutr... 105 7e-21 gb|ACQ59090.1| BTB/POZ protein [Nicotiana benthamiana] 105 9e-21 ref|XP_007051653.1| POZ/BTB containin G-protein 1 isoform 6 [The... 104 1e-20 ref|XP_007051652.1| POZ/BTB containin G-protein 1 isoform 5 [The... 104 1e-20 ref|XP_007051651.1| POZ/BTB containin G-protein 1 isoform 4 [The... 104 1e-20 ref|XP_007051650.1| POZ/BTB containin G-protein 1 isoform 3 [The... 104 1e-20 ref|XP_007051649.1| POZ/BTB containin G-protein 1 isoform 2 [The... 104 1e-20 ref|XP_007051648.1| POZ/BTB containin G-protein 1 isoform 1 [The... 104 1e-20 ref|XP_006293934.1| hypothetical protein CARUB_v10022924mg [Caps... 104 1e-20 ref|XP_006293933.1| hypothetical protein CARUB_v10022924mg [Caps... 104 1e-20 emb|CBI40464.3| unnamed protein product [Vitis vinifera] 104 1e-20 ref|XP_002279915.1| PREDICTED: BTB/POZ domain-containing protein... 104 1e-20 ref|XP_007218966.1| hypothetical protein PRUPE_ppa003673mg [Prun... 103 2e-20 ref|XP_002320175.2| BTB/POZ domain-containing family protein [Po... 103 2e-20 gb|EPS68073.1| hypothetical protein M569_06692, partial [Genlise... 103 2e-20 gb|EYU32197.1| hypothetical protein MIMGU_mgv1a003926mg [Mimulus... 103 3e-20 ref|XP_006358650.1| PREDICTED: BTB/POZ domain-containing protein... 102 4e-20 ref|XP_006444906.1| hypothetical protein CICLE_v10019570mg [Citr... 102 4e-20 >gb|EYU38917.1| hypothetical protein MIMGU_mgv1a0037492mg, partial [Mimulus guttatus] Length = 275 Score = 110 bits (274), Expect = 3e-22 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKREV 167 YISKYKGNYTFTGGKAVGYRNLF+IPWTSF+AEDSLYFIN +LHLRAELTIKRE+ Sbjct: 219 YISKYKGNYTFTGGKAVGYRNLFNIPWTSFVAEDSLYFINGVLHLRAELTIKREI 273 >ref|XP_006402466.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] gi|557103565|gb|ESQ43919.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] Length = 613 Score = 105 bits (262), Expect = 7e-21 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 +ISKYKGNYTFTGGKAVGYRNLF IPWTSF+AEDSLYFIN ILHLRAELTIKR Sbjct: 556 FISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIKR 608 >ref|XP_006402465.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] gi|557103564|gb|ESQ43918.1| hypothetical protein EUTSA_v10005840mg [Eutrema salsugineum] Length = 603 Score = 105 bits (262), Expect = 7e-21 Identities = 49/53 (92%), Positives = 51/53 (96%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 +ISKYKGNYTFTGGKAVGYRNLF IPWTSF+AEDSLYFIN ILHLRAELTIKR Sbjct: 546 FISKYKGNYTFTGGKAVGYRNLFGIPWTSFIAEDSLYFINGILHLRAELTIKR 598 >gb|ACQ59090.1| BTB/POZ protein [Nicotiana benthamiana] Length = 552 Score = 105 bits (261), Expect = 9e-21 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIK 158 Y+SKYKGNYTFTGGKAVGYRNLF+IPWTSFMAEDSLYFIN +LHLRAELTI+ Sbjct: 500 YVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR 551 >ref|XP_007051653.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao] gi|508703914|gb|EOX95810.1| POZ/BTB containin G-protein 1 isoform 6 [Theobroma cacao] Length = 525 Score = 104 bits (259), Expect = 1e-20 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 ++SKYKGNYTFTGGKAVGYRNLF+IPWTSFMAEDSLYFIN ILHLRAELTI++ Sbjct: 473 FVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ 525 >ref|XP_007051652.1| POZ/BTB containin G-protein 1 isoform 5 [Theobroma cacao] gi|508703913|gb|EOX95809.1| POZ/BTB containin G-protein 1 isoform 5 [Theobroma cacao] Length = 380 Score = 104 bits (259), Expect = 1e-20 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 ++SKYKGNYTFTGGKAVGYRNLF+IPWTSFMAEDSLYFIN ILHLRAELTI++ Sbjct: 328 FVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ 380 >ref|XP_007051651.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao] gi|508703912|gb|EOX95808.1| POZ/BTB containin G-protein 1 isoform 4 [Theobroma cacao] Length = 413 Score = 104 bits (259), Expect = 1e-20 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 ++SKYKGNYTFTGGKAVGYRNLF+IPWTSFMAEDSLYFIN ILHLRAELTI++ Sbjct: 361 FVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ 413 >ref|XP_007051650.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao] gi|508703911|gb|EOX95807.1| POZ/BTB containin G-protein 1 isoform 3 [Theobroma cacao] Length = 468 Score = 104 bits (259), Expect = 1e-20 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 ++SKYKGNYTFTGGKAVGYRNLF+IPWTSFMAEDSLYFIN ILHLRAELTI++ Sbjct: 416 FVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ 468 >ref|XP_007051649.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao] gi|508703910|gb|EOX95806.1| POZ/BTB containin G-protein 1 isoform 2 [Theobroma cacao] Length = 460 Score = 104 bits (259), Expect = 1e-20 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 ++SKYKGNYTFTGGKAVGYRNLF+IPWTSFMAEDSLYFIN ILHLRAELTI++ Sbjct: 408 FVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ 460 >ref|XP_007051648.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao] gi|508703909|gb|EOX95805.1| POZ/BTB containin G-protein 1 isoform 1 [Theobroma cacao] Length = 552 Score = 104 bits (259), Expect = 1e-20 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 ++SKYKGNYTFTGGKAVGYRNLF+IPWTSFMAEDSLYFIN ILHLRAELTI++ Sbjct: 500 FVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGILHLRAELTIRQ 552 >ref|XP_006293934.1| hypothetical protein CARUB_v10022924mg [Capsella rubella] gi|482562642|gb|EOA26832.1| hypothetical protein CARUB_v10022924mg [Capsella rubella] Length = 560 Score = 104 bits (259), Expect = 1e-20 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 ++SKYKGNYTFTGGKAVGYRNLF +PWTSFMAEDSL+FIN ILHLRAELTIKR Sbjct: 503 FVSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSLHFINGILHLRAELTIKR 555 >ref|XP_006293933.1| hypothetical protein CARUB_v10022924mg [Capsella rubella] gi|482562641|gb|EOA26831.1| hypothetical protein CARUB_v10022924mg [Capsella rubella] Length = 453 Score = 104 bits (259), Expect = 1e-20 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 ++SKYKGNYTFTGGKAVGYRNLF +PWTSFMAEDSL+FIN ILHLRAELTIKR Sbjct: 396 FVSKYKGNYTFTGGKAVGYRNLFGVPWTSFMAEDSLHFINGILHLRAELTIKR 448 >emb|CBI40464.3| unnamed protein product [Vitis vinifera] Length = 501 Score = 104 bits (259), Expect = 1e-20 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIK 158 YISKYKGNYTFTGGKAVGYRNLF+IPWTSF+AEDSLYFIN ILHLRAELTI+ Sbjct: 449 YISKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIR 500 >ref|XP_002279915.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Vitis vinifera] Length = 553 Score = 104 bits (259), Expect = 1e-20 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIK 158 YISKYKGNYTFTGGKAVGYRNLF+IPWTSF+AEDSLYFIN ILHLRAELTI+ Sbjct: 501 YISKYKGNYTFTGGKAVGYRNLFAIPWTSFVAEDSLYFINGILHLRAELTIR 552 >ref|XP_007218966.1| hypothetical protein PRUPE_ppa003673mg [Prunus persica] gi|462415428|gb|EMJ20165.1| hypothetical protein PRUPE_ppa003673mg [Prunus persica] Length = 557 Score = 103 bits (258), Expect = 2e-20 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIK 158 +ISKYKGNYTFTGGKAVGYRNLF+IPWTSFMAEDSLYFIN +LHLRAELTI+ Sbjct: 505 FISKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR 556 >ref|XP_002320175.2| BTB/POZ domain-containing family protein [Populus trichocarpa] gi|550323798|gb|EEE98490.2| BTB/POZ domain-containing family protein [Populus trichocarpa] Length = 548 Score = 103 bits (257), Expect = 2e-20 Identities = 46/52 (88%), Positives = 51/52 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIK 158 ++SKYKGNYTFTGGKAVGYRNLF+IPWTSFMAEDSLYFIN +LHLRAELTI+ Sbjct: 496 FVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFINGVLHLRAELTIR 547 >gb|EPS68073.1| hypothetical protein M569_06692, partial [Genlisea aurea] Length = 577 Score = 103 bits (257), Expect = 2e-20 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKREV 167 ++SKYKGNYTFTGGKAVGYRNLFS+PW SFMAEDS YFIN ILHLRAELTIK+E+ Sbjct: 523 FVSKYKGNYTFTGGKAVGYRNLFSMPWNSFMAEDSNYFINGILHLRAELTIKKEL 577 >gb|EYU32197.1| hypothetical protein MIMGU_mgv1a003926mg [Mimulus guttatus] Length = 555 Score = 103 bits (256), Expect = 3e-20 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIKR 161 YISKYKGNYTFTGGKAVGYRNLFS+ WT+FMAEDSLYFIN +LHLRAELTIK+ Sbjct: 503 YISKYKGNYTFTGGKAVGYRNLFSLQWTNFMAEDSLYFINGVLHLRAELTIKQ 555 >ref|XP_006358650.1| PREDICTED: BTB/POZ domain-containing protein POB1-like [Solanum tuberosum] Length = 551 Score = 102 bits (255), Expect = 4e-20 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIK 158 Y+SKYKGNYTFTGGKAVGYRNLF+IPWTSFMAEDSLYFI +LHLRAELTI+ Sbjct: 499 YVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMAEDSLYFIKGVLHLRAELTIR 550 >ref|XP_006444906.1| hypothetical protein CICLE_v10019570mg [Citrus clementina] gi|557547168|gb|ESR58146.1| hypothetical protein CICLE_v10019570mg [Citrus clementina] Length = 550 Score = 102 bits (255), Expect = 4e-20 Identities = 46/52 (88%), Positives = 51/52 (98%) Frame = +3 Query: 3 YISKYKGNYTFTGGKAVGYRNLFSIPWTSFMAEDSLYFINDILHLRAELTIK 158 ++SKYKGNYTFTGGKAVGYRNLF+IPWTSFMA+DSLYFIN ILHLRAELTI+ Sbjct: 498 FVSKYKGNYTFTGGKAVGYRNLFAIPWTSFMADDSLYFINGILHLRAELTIR 549