BLASTX nr result
ID: Mentha22_contig00020101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00020101 (535 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF17633.1| putative acetyl co-enzyme A carboxylase carboxylt... 59 7e-07 >gb|ACF17633.1| putative acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit [Capsicum annuum] Length = 757 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/57 (57%), Positives = 41/57 (71%), Gaps = 3/57 (5%) Frame = -1 Query: 526 EIKQTINEAMSIPELKEKHERLAAEILES---SNGSLDKXXXXXESKVKINQDTNRS 365 +IKQ++ +AMS PELKEKHERL AEI+ES SNGSL +S V++N D NRS Sbjct: 699 QIKQSLAQAMSFPELKEKHERLKAEIVESPEGSNGSLLADNDGFKSGVEVNVDANRS 755