BLASTX nr result
ID: Mentha22_contig00017620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00017620 (409 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46010.1| hypothetical protein MIMGU_mgv1a004541mg [Mimulus... 74 2e-11 ref|XP_002276607.2| PREDICTED: uncharacterized protein LOC100253... 59 5e-07 emb|CBI15828.3| unnamed protein product [Vitis vinifera] 59 5e-07 gb|EPS71586.1| hypothetical protein M569_03173, partial [Genlise... 59 9e-07 ref|XP_006350879.1| PREDICTED: uncharacterized protein LOC102602... 58 2e-06 ref|XP_007017069.1| NT domain of poly(A) polymerase and terminal... 57 3e-06 ref|XP_007017068.1| NT domain of poly(A) polymerase and terminal... 57 3e-06 gb|EYU36910.1| hypothetical protein MIMGU_mgv1a018823mg [Mimulus... 57 4e-06 >gb|EYU46010.1| hypothetical protein MIMGU_mgv1a004541mg [Mimulus guttatus] Length = 521 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/67 (50%), Positives = 47/67 (70%) Frame = -2 Query: 408 RSAFKFGAHKLGHILLRPRDEVVDEIRKYFSSTRARHEHQHRNSNRNLALEFSDEESLTA 229 RSAFK+GA KLG + +P+D++ DEI ++F+ T ARH +R+ + L LEF DE+S TA Sbjct: 331 RSAFKYGARKLGKVFQQPKDKIADEISEFFADTIARHGSDYRSGTQGLTLEFGDEDSSTA 390 Query: 228 SLPSPVE 208 SPVE Sbjct: 391 YSSSPVE 397 >ref|XP_002276607.2| PREDICTED: uncharacterized protein LOC100253523 [Vitis vinifera] Length = 854 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = -2 Query: 408 RSAFKFGAHKLGHILLRPRDEVVDEIRKYFSSTRARHEHQHRNSNRNLALEFSDEESLTA 229 RSAFK+G+HKLG IL PR+ + DE++ +F+ST RH ++ +N AL F S ++ Sbjct: 339 RSAFKYGSHKLGQILSLPREVIQDELKNFFASTLERHRSKYMAEIQNSALTFGSRGSSSS 398 Query: 228 SLPSPVE 208 S S E Sbjct: 399 SSSSGTE 405 >emb|CBI15828.3| unnamed protein product [Vitis vinifera] Length = 929 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/67 (43%), Positives = 42/67 (62%) Frame = -2 Query: 408 RSAFKFGAHKLGHILLRPRDEVVDEIRKYFSSTRARHEHQHRNSNRNLALEFSDEESLTA 229 RSAFK+G+HKLG IL PR+ + DE++ +F+ST RH ++ +N AL F S ++ Sbjct: 414 RSAFKYGSHKLGQILSLPREVIQDELKNFFASTLERHRSKYMAEIQNSALTFGSRGSSSS 473 Query: 228 SLPSPVE 208 S S E Sbjct: 474 SSSSGTE 480 >gb|EPS71586.1| hypothetical protein M569_03173, partial [Genlisea aurea] Length = 347 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/66 (48%), Positives = 42/66 (63%) Frame = -2 Query: 408 RSAFKFGAHKLGHILLRPRDEVVDEIRKYFSSTRARHEHQHRNSNRNLALEFSDEESLTA 229 RSA K+G+ KL IL RPRDEV EIR +F++ RHEH+ + ++ DEE LTA Sbjct: 267 RSALKYGSCKLDQILSRPRDEVASEIRVFFANACERHEHRQKGPALDVV---GDEEFLTA 323 Query: 228 SLPSPV 211 S+ S V Sbjct: 324 SVSSSV 329 >ref|XP_006350879.1| PREDICTED: uncharacterized protein LOC102602843 [Solanum tuberosum] Length = 844 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/65 (49%), Positives = 41/65 (63%) Frame = -2 Query: 402 AFKFGAHKLGHILLRPRDEVVDEIRKYFSSTRARHEHQHRNSNRNLALEFSDEESLTASL 223 AFK+GA KLG ILL P D+V DEI+K+F++T RH H + +L F DE+ T S Sbjct: 333 AFKYGARKLGDILLSPDDKVADEIKKFFANTIERHRLNHVAELQYSSLIFGDED--TCSS 390 Query: 222 PSPVE 208 SP E Sbjct: 391 LSPAE 395 >ref|XP_007017069.1| NT domain of poly(A) polymerase and terminal uridylyl transferase-containing protein, putative isoform 2 [Theobroma cacao] gi|508787432|gb|EOY34688.1| NT domain of poly(A) polymerase and terminal uridylyl transferase-containing protein, putative isoform 2 [Theobroma cacao] Length = 836 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = -2 Query: 408 RSAFKFGAHKLGHILLRPRDEVVDEIRKYFSSTRARHEHQHRNSNRNLALEFSDEESLTA 229 RSAFK+GAHKL IL+ PR+ + DE+ K+F++T RH H +NL SD Sbjct: 346 RSAFKYGAHKLEQILILPRERIPDELVKFFANTLERHGSNHLTGMQNLP-STSDARGYDH 404 Query: 228 SLPSP 214 +PSP Sbjct: 405 VMPSP 409 >ref|XP_007017068.1| NT domain of poly(A) polymerase and terminal uridylyl transferase-containing protein, putative isoform 1 [Theobroma cacao] gi|508787431|gb|EOY34687.1| NT domain of poly(A) polymerase and terminal uridylyl transferase-containing protein, putative isoform 1 [Theobroma cacao] Length = 836 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = -2 Query: 408 RSAFKFGAHKLGHILLRPRDEVVDEIRKYFSSTRARHEHQHRNSNRNLALEFSDEESLTA 229 RSAFK+GAHKL IL+ PR+ + DE+ K+F++T RH H +NL SD Sbjct: 346 RSAFKYGAHKLEQILILPRERIPDELVKFFANTLERHGSNHLTGMQNLP-STSDARGYDH 404 Query: 228 SLPSP 214 +PSP Sbjct: 405 VMPSP 409 >gb|EYU36910.1| hypothetical protein MIMGU_mgv1a018823mg [Mimulus guttatus] Length = 819 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/56 (53%), Positives = 35/56 (62%), Gaps = 2/56 (3%) Frame = -2 Query: 408 RSAFKFGAHKLGHILLRPRDEVVDEIRKYFSSTRARHEHQ--HRNSNRNLALEFSD 247 RSAFKFGAH+LG IL RP + + DEI F TR RH +Q + R LEFSD Sbjct: 350 RSAFKFGAHRLGEILQRPIETISDEISALFEQTRGRHANQCTSTSKRRLTVLEFSD 405