BLASTX nr result
ID: Mentha22_contig00017296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00017296 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Mimulus... 66 4e-09 gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 ... 66 4e-09 ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane prot... 66 4e-09 ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citr... 66 4e-09 ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane prot... 66 4e-09 ref|XP_002520135.1| voltage-dependent anion-selective channel, p... 66 4e-09 gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea] 65 7e-09 emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] 65 1e-08 ref|XP_004489372.1| PREDICTED: outer plastidial membrane protein... 65 1e-08 ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane prot... 65 1e-08 ref|NP_001275134.1| mitochondrial outer membrane protein porin o... 65 1e-08 dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum] 65 1e-08 ref|XP_002312708.1| porin family protein [Populus trichocarpa] g... 65 1e-08 ref|XP_004302356.1| PREDICTED: mitochondrial outer membrane prot... 65 1e-08 ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prun... 65 1e-08 gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca] 65 1e-08 ref|XP_003631280.1| PREDICTED: mitochondrial outer membrane prot... 64 2e-08 ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane prot... 64 2e-08 ref|XP_006482536.1| PREDICTED: mitochondrial outer membrane prot... 64 3e-08 ref|XP_006431074.1| hypothetical protein CICLE_v10012445mg [Citr... 64 3e-08 >gb|EYU28705.1| hypothetical protein MIMGU_mgv1a011554mg [Mimulus guttatus] Length = 278 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SLITI+GEVDTRAIEKSAK+GLA+ALKP Sbjct: 245 HEWRPKSLITISGEVDTRAIEKSAKVGLAVALKP 278 >gb|EXB63818.1| Mitochondrial outer membrane protein porin of 36 kDa [Morus notabilis] Length = 276 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDTRAIEKSAKIGLALALKP Sbjct: 243 HEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_006483230.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Citrus sinensis] Length = 276 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDTRAIEKSAKIGLALALKP Sbjct: 243 HEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_006438620.1| hypothetical protein CICLE_v10032366mg [Citrus clementina] gi|557540816|gb|ESR51860.1| hypothetical protein CICLE_v10032366mg [Citrus clementina] Length = 276 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDTRAIEKSAKIGLALALKP Sbjct: 243 HEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_004297335.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Fragaria vesca subsp. vesca] Length = 276 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDTRAIEKSAKIGLALALKP Sbjct: 243 HEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_002520135.1| voltage-dependent anion-selective channel, putative [Ricinus communis] gi|223540627|gb|EEF42190.1| voltage-dependent anion-selective channel, putative [Ricinus communis] Length = 276 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDTRAIEKSAKIGLALALKP Sbjct: 243 HEWRPKSLFTISGEVDTRAIEKSAKIGLALALKP 276 >gb|EPS68383.1| hypothetical protein M569_06388 [Genlisea aurea] Length = 278 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SLITI+GEVDTRAIEK+AKIGLA+ALKP Sbjct: 245 HEWRPKSLITISGEVDTRAIEKTAKIGLAVALKP 278 >emb|CAA56601.1| 36kDa porin I [Solanum tuberosum] Length = 276 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDTRAIEKSAKIGLA+ALKP Sbjct: 243 HEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_004489372.1| PREDICTED: outer plastidial membrane protein porin-like [Cicer arietinum] Length = 276 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRPRS +TI+GEVDT+AIEKSAK+GLALALKP Sbjct: 243 HEWRPRSFLTISGEVDTKAIEKSAKVGLALALKP 276 >ref|XP_004228386.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa-like [Solanum lycopersicum] Length = 276 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDTRAIEKSAKIGLA+ALKP Sbjct: 243 HEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|NP_001275134.1| mitochondrial outer membrane protein porin of 36 kDa [Solanum tuberosum] gi|1172556|sp|P42056.2|VDAC2_SOLTU RecName: Full=Mitochondrial outer membrane protein porin of 36 kDa; AltName: Full=POM 36; AltName: Full=Voltage-dependent anion-selective channel protein; Short=VDAC gi|515360|emb|CAA56600.1| 36kDA porin II [Solanum tuberosum] Length = 276 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDTRAIEKSAKIGLA+ALKP Sbjct: 243 HEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >dbj|BAF95071.1| voltage-dependent anion channel [Nicotiana tabacum] Length = 276 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDTRAIEKSAKIGLA+ALKP Sbjct: 243 HEWRPKSLFTISGEVDTRAIEKSAKIGLAVALKP 276 >ref|XP_002312708.1| porin family protein [Populus trichocarpa] gi|118484777|gb|ABK94257.1| unknown [Populus trichocarpa] gi|222852528|gb|EEE90075.1| porin family protein [Populus trichocarpa] Length = 276 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDT+AIEKSAKIGLALALKP Sbjct: 243 HEWRPKSLFTISGEVDTKAIEKSAKIGLALALKP 276 >ref|XP_004302356.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Fragaria vesca subsp. vesca] Length = 276 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+S TI+GEVDTRAIEKSAKIGLALALKP Sbjct: 243 HEWRPKSFFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_007222361.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica] gi|462419297|gb|EMJ23560.1| hypothetical protein PRUPE_ppa008111mg [Prunus persica] Length = 344 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+S TI+GEVDTRAIEKSAKIGLALALKP Sbjct: 311 HEWRPKSFFTISGEVDTRAIEKSAKIGLALALKP 344 >gb|AAD38145.1|AF139498_1 porin [Prunus armeniaca] Length = 276 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+S TI+GEVDTRAIEKSAKIGLALALKP Sbjct: 243 HEWRPKSFFTISGEVDTRAIEKSAKIGLALALKP 276 >ref|XP_003631280.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa isoform 2 [Vitis vinifera] Length = 247 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVD RA+EKSAKIGLALALKP Sbjct: 214 HEWRPKSLFTISGEVDARAVEKSAKIGLALALKP 247 >ref|XP_002276636.1| PREDICTED: mitochondrial outer membrane protein porin of 36 kDa isoform 1 [Vitis vinifera] Length = 276 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVD RA+EKSAKIGLALALKP Sbjct: 243 HEWRPKSLFTISGEVDARAVEKSAKIGLALALKP 276 >ref|XP_006482536.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Citrus sinensis] Length = 274 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDT+AIEKSAK GLALALKP Sbjct: 241 HEWRPKSLFTISGEVDTKAIEKSAKFGLALALKP 274 >ref|XP_006431074.1| hypothetical protein CICLE_v10012445mg [Citrus clementina] gi|557533131|gb|ESR44314.1| hypothetical protein CICLE_v10012445mg [Citrus clementina] Length = 274 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 377 HEWRPRSLITITGEVDTRAIEKSAKIGLALALKP 276 HEWRP+SL TI+GEVDT+AIEKSAK GLALALKP Sbjct: 241 HEWRPKSLFTISGEVDTKAIEKSAKFGLALALKP 274