BLASTX nr result
ID: Mentha22_contig00017280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00017280 (685 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524514.1| ATP binding protein, putative [Ricinus commu... 59 1e-06 >ref|XP_002524514.1| ATP binding protein, putative [Ricinus communis] gi|223536188|gb|EEF37841.1| ATP binding protein, putative [Ricinus communis] Length = 1007 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 556 DLSFNKLTGRIPPDLSSSRKGD-IYLTGNSLNGTVPELMKSKGN 684 DLSFNKLTG IP D S+ +K D IYLTGN LNGTVP+ + KGN Sbjct: 306 DLSFNKLTGGIPSDFSNIQKADYIYLTGNRLNGTVPDWILQKGN 349